KEGG   Enterococcus faecalis Symbioflor 1: EFS1_1474Help
Entry
EFS1_1474         CDS       T02399                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
efs  Enterococcus faecalis Symbioflor 1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efs00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EFS1_1474 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EFS1_1474 (pyrB)
Enzymes [BR:efs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     EFS1_1474 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1525037..1525963)
Genome map
AA seq 308 aa AA seqDB search
MIITSERISLKHLLTAEALTDREVMGLIRRAGEFKQGAKWHPEERQYFATNLFFENSTRT
HKSFEVAEKKLGLEVIEFEASRSSVQKGETLYDTVLTMSAIGVDVAVIRHGKENYYDELI
QSKTIQCSIINGGDGSGQHPTQCLLDLMTIYEEFGGFEGLKVAIVGDITHSRVAKSNMQL
LNRLGAEIYFSGPEEWYDHQFDVYGQYVPLDEIVEKVDVMMLLRVQHERHDGKESFSKEG
YHLEYGLTNERATRLQKHAIIMHPAPVNRDVELADELVESLQSRIVAQMSNGVFMRMAIL
EAILHGKA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgattattacatctgaacgaattagtttaaaacatcttttaactgcagaggctttaacc
gaccgtgaagtcatggggttaatccgtcgcgcaggagaatttaaacagggggcaaaatgg
cacccagaagaacgtcaatattttgcaacaaacttgttttttgaaaatagtactcgaaca
cataaaagttttgaggtagctgagaaaaaattaggcttagaagtgattgagtttgaagca
agtagaagttctgttcaaaaaggagaaacgttatacgacacagtactaacgatgtcggca
attggtgtagatgtagcagtcattcgtcatggtaaagaaaattattacgatgaattgatt
caaagtaaaacgattcaatgttctattattaacggtggggacgggagtggacaacaccct
acacaatgtttattggatctgatgactatttatgaagaatttggtggatttgaaggcttg
aaagtggcgattgtgggagatattacacattctcgcgttgctaaatcaaatatgcagtta
ttaaaccgtttaggcgctgaaatttatttttcaggtccagaagagtggtacgatcatcag
tttgatgtctatggacaatatgtgccattagatgaaattgttgaaaaagtcgatgtgatg
atgttgcttcgcgtgcagcacgaacgtcatgatggtaaggaaagtttttcaaaagaaggc
tatcatttggaatatggtttaaccaacgaacgggcaactcgtttacagaaacacgcaatt
attatgcatccagcgccagtcaatcgggatgttgaactggcagatgaattagtggaaagt
ctgcaatcaagaatcgtcgcgcaaatgagtaacggagtctttatgcgcatggcaattttg
gaagcaattttacatggaaaggcctag

DBGET integrated database retrieval system