KEGG   Enterococcus faecalis Symbioflor 1: EFS1_1649Help
Entry
EFS1_1649         CDS       T02399                                 

Definition
transcriptional regulator, LacI family/carbohydrate kinase, PfkB family protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
efs  Enterococcus faecalis Symbioflor 1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:efs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EFS1_1649
Enzymes [BR:efs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EFS1_1649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1678254..1680164
Genome map
AA seq 636 aa AA seqDB search
MNIKDIAKLAGVSASTVSKIINNKDQTISKETRERVLKIVRDYNYTPYSANLVTNSTTKT
FVLLLNSHETFEAWVTSFIDKAQENGYNCLILNSHGSLEQELKNITSPTLKQASGIIWDP
INENSKQYAKFIEELTIPYYFVNHSTNELPSLAGLYEEASYVLTQELLQNNHKKISYFVT
NPKYKEAIIAGYKKALFDVNLPFSKENILTTIPADFSNQLITDGITGILTDDYTQAVFLE
QLLKQSGLRTPDNYSLLAIKRKIDRSFLPDHISSVLLDTETFGSQLALLLLNKRKEKTAL
INEAEKLVLDHKNTLGMSSVNPDSKMIVVGSLNVDNYLYSTNLPHNGKTNFLSSYAKFPG
GKGLNQAVGLTKLGHQATLIGCLGSDTDANYLYKELEKYHVTTDGITRIQDTETGQAYIY
VETSGDSMISILPGANTALTPKKIAQQKHLFMDASFCLIQTEIPLSAVEKACEIAQHSGV
PIILKPAAIHHIPVNILEKVDFFIPNEDELLELQPDTGTLEEKAAYFLEMGVKNVIVTLG
KKGVLLKTPQVCHYFPATENIAVDSTGASDSFISALASYLSKGYPTEAAIQIAIQAAGFS
VSKEGVIDSLVDHVTLENYLIKKEPALFAHRNTCVD
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaaagatattgcaaaattagctggcgtttccgcttcaactgtatccaaaatt
ataaataataaagatcaaaccattagtaaagaaacccgtgagcgtgtcttaaaaatcgtt
cgagattacaactacacaccttactcagcaaatctcgtcacaaatagtactacaaaaacc
ttcgtgttattattaaatagccatgaaacttttgaggcttgggttacgagctttattgat
aaagctcaagaaaatggctataactgcttgattttaaatagtcacggtagtttagaacaa
gaactgaaaaatattacctcgccaactttaaaacaagccagtggcattatttgggaccca
atcaatgaaaacagtaaacaatacgcgaaatttatagaagaattaacgattccttactat
ttcgtcaatcactcaactaacgaattaccttctctagcggggctttatgaagaagctagt
tatgttttaacccaagaattattacagaataaccataaaaaaattagttatttcgtcact
aacccaaaatataaagaagcaattattgcaggctataaaaaagccttgtttgatgtcaat
ttaccctttagtaaagaaaatattttaactactatccctgctgatttcagtaatcagctt
atcacagatgggattacgggtatccttactgatgactatacccaggctgtttttttggaa
cagcttttaaagcagagcggtttgcgaacccccgataattactctttactcgcaattaag
cgaaaaattgatcgttcatttttacctgatcatatttcttccgtcttattagatacagag
acgtttggcagccagttagccttattattgcttaacaaacgcaaagaaaaaacagccttg
attaatgaggctgaaaaattggtgctagatcacaaaaatacattaggcatgtctagtgtt
aatccagatagcaaaatgattgtagtaggtagtttaaacgttgataattatctgtattca
acaaatttaccacataacggcaaaacaaattttttgtctagctatgctaaattccccggc
ggaaaaggattaaatcaagctgttggcttaaccaaactggggcatcaggccaccttaatt
ggttgtttaggctcagacacagatgcgaattacttatataaagaattagaaaaataccac
gttacgacagatggtatcacacgtattcaagatactgagactggtcaagcttatatttat
gttgagacaagcggcgactccatgatttcaatcttacctggtgcaaacacagcgcttaca
cctaaaaaaatcgcacagcaaaaacacctatttatggatgccagtttttgtctcattcaa
acagaaattcctttgtctgctgtagagaaagcttgtgaaatcgcccaacattcaggggta
ccgattattttaaaaccagctgctattcatcatattccagtgaatatactagaaaaggtt
gattttttcattcccaatgaagatgaattattggaacttcaaccagatactggtacatta
gaagagaaagcggcgtacttcttagaaatgggcgtaaaaaatgtcattgttactttagga
aaaaaaggcgtgttattaaaaacaccccaagtgtgccactatttccctgcaacagaaaat
atagctgtggatagcactggtgccagtgacagctttatcagcgcgctcgcctcctatctt
tcgaaaggttatccaactgaagcagccattcaaatagcaattcaggctgcaggattttca
gtttctaaagaaggggtgattgattctttagttgatcacgtcactttggaaaattatttg
ataaaaaaagaacccgctctttttgctcatcgtaacacctgtgtcgactga

DBGET integrated database retrieval system