KEGG   Enterococcus faecalis Symbioflor 1: EFS1_2034Help
Entry
EFS1_2034         CDS       T02399                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
efs  Enterococcus faecalis Symbioflor 1
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:efs00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2069770..2070354)
Genome map
AA seq 194 aa AA seqDB search
MAQLFFKYGAMNSGKTIEILKVAHNYEEQDKPVVLMTSGLDTRDGVGKVSSRIGLRRDAI
PIFEETNVFDLINDLSYKPFCVLVDECQFLNKHHVIEFARIVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLYADKLEELKTICWFCHKKATMNLHYIDGKPVYEGDQVQIGGNEAYYPVC
RKHYFHPKTVNEEQ
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctcaattatttttcaagtatggcgcaatgaacagtggtaaaaccattgaaatctta
aaagtagcacacaattacgaagaacaagacaaaccagttgttttgatgaccagtggacta
gatacacgtgatggtgttgggaaagtatccagtcgcatcggattacgcagagatgctatt
ccaatttttgaagaaaccaatgtctttgacttgattaatgatttgtcttacaaacctttt
tgcgtattagtcgatgaatgtcaatttttaaacaagcatcatgtcattgaatttgcacga
attgttgacgaattagatattccagtaatggcatttgggctaaagaatgattttagaaat
gaattatttgaaggctcaaagtatttacttttatatgcagacaaattagaagaattaaaa
acgatttgctggttctgtcataaaaaagcaactatgaacttgcactatattgatggcaaa
cccgtttatgaaggggatcaagtccaaattggtgggaatgaagcctactatcctgtttgt
cgcaaacattattttcatccaaaaacagtgaatgaagaacagtaa

DBGET integrated database retrieval system