KEGG   Enterococcus faecalis Symbioflor 1: EFS1_2062Help
Entry
EFS1_2062         CDS       T02399                                 

Definition
mur ligase family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
efs  Enterococcus faecalis Symbioflor 1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:efs00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:efs00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2103624..2104976
Genome map
AA seq 450 aa AA seqDB search
MGIRSHLAIAAGKTSQWVLQTFFKGGSSYPGKLALKIDPKILDTLAKDYEIVVVTGTNGK
TLTTALTVNILRQEFDEVLTNPTGANMEQGIVSTFLNAKAKKGQKKFAVLEIDEASLSRV
TKYIQPKLFVFTNIFRDQMDRYGEIYTTYRLIMEGAAAAPEATILCNGDSPIFNSKETVN
PRKYYGFNHLPPKEQLAHYNTDGVLCPKCNHILHYKMITYANLGDYYCPNCGFKRPELDV
QLTEMVRMDNTSADFVIDGEEYGIAVGGMYNVYNALAATAVAEYYQVAPDKIRAGLAYDE
KVFGRQETIKVGDKECTLVLVKNPVGLNQVIDMMGLAPYSFSLVSLLNANYADGIDVSWI
WDGNHEAFADMDIPKVIAGGDRHEDMALRLKVAGIPEEKLLEIADLEQVISEIKTLPTDH
VYILATYTAVLQLRKSLTAQGYIQGGMNGV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggggattcgaagtcatttagcaattgctgcaggaaaaacttcgcaatgggttttacaa
acattttttaaaggcggcagtagctacccagggaaattagccctaaaaatcgatcctaaa
attttagatacattggcaaaagactatgaaattgtcgtagtcactggaacgaacggcaaa
acattgacaactgctttaactgttaacattttacgccaagaatttgatgaggtattaaca
aatccaacgggtgctaacatggagcaaggaattgtctctacttttttaaatgccaaggcg
aaaaaaggacaaaagaaatttgcggtgttagaaattgatgaagcaagtttaagccgtgtc
actaaatatattcaaccaaaattatttgtttttacgaatattttccgcgaccaaatggat
cgctatggtgaaatttatacgacgtatcgcttaattatggaaggcgccgctgctgctcct
gaagcaactattttgtgcaatggtgattcgccaatttttaattcaaaagaaactgtaaat
cctcgcaaatactatggatttaatcatttaccaccgaaagagcaattggctcattacaat
acagatggggttttatgtccaaaatgtaatcatattcttcattataaaatgattacgtat
gctaatttaggtgattactattgcccaaattgtggcttcaaacgccctgaattggatgtg
cagttaacggaaatggtccggatggataatacatctgctgattttgtgattgatggcgaa
gaatacggcattgctgttggtgggatgtataatgtttataatgcgctagcggccacagcg
gtagcagaatattatcaggtggcaccagataaaatccgagcaggcttagcttatgatgaa
aaagtttttgggcgtcaagaaaccattaaagttggcgataaagaatgtacgttagtttta
gtaaaaaatcccgttggtttaaatcaggtcattgatatgatgggcttagccccttactct
ttctcgctggtttcattattaaatgctaattatgcagatggaattgatgtcagttggatt
tgggatggtaatcatgaagcctttgctgatatggacattccaaaagtaattgctggcggt
gatcgccatgaagatatggccttgcgtttaaaagttgcgggtattcctgaagaaaaatta
ctagaaattgctgatttagagcaagtaatttcagaaattaaaacgttgccgacagatcat
gtctatattttggcaacctatactgctgttttgcaattaagaaaatcattaacagcccaa
gggtatattcaagggggaatgaatggtgtctaa

DBGET integrated database retrieval system