KEGG   Enterococcus faecalis Symbioflor 1: EFS1_2092Help
Entry
EFS1_2092         CDS       T02399                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
efs  Enterococcus faecalis Symbioflor 1
Brite
Enzymes [BR:efs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     EFS1_2092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2134681..2135445)
Genome map
AA seq 254 aa AA seqDB search
MAKKINLPKPLFSEKGKRAVLLLHAYSGSSNDVRMLSRRLEKENYTVYSPNFSGHGTLVP
EDILDQTTEQWWQDTQEAVAFLRERGYQEIAIFGLSMGGIFSMHALTEQLTGLIGGGFFC
SPIYPVENKVPENFVLYAENVMKIAEVPAEEQQSRLQSIEQRVKQQLGAIETIASQTADK
LNKIHAPLFLAQAGKDEMIEPMGVYQTAQALTQARVTLQWYPNSGHVITVSGEHKQLEQD
VVQFLATLPWNEEK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaaaaaatcaatttaccgaagccgttattttcagaaaaaggaaaacgggcggtc
cttttattacatgcttattctggcagcagtaatgatgtacggatgttaagcagacgttta
gaaaaagaaaattatactgtctattcgcctaatttttcaggacatggcacgctagttcct
gaagatattttagatcaaacaacggaacaatggtggcaagatacacaagaagcagtcgct
tttttgagagaaagaggctaccaagaaattgccatttttggtttatcaatgggcgggatt
ttcagtatgcatgcattaacggaacaattaacaggattaattggtggtggatttttctgt
tcaccgatctaccctgtcgaaaataaagtcccagaaaatttcgtattatacgcagaaaac
gtgatgaaaatcgcagaagttcctgcagaggaacaacaaagccggttgcaatcgattgag
caacgagtcaaacaacaattaggagcgattgaaacaattgctagtcagacggcagacaaa
ctaaacaaaatccacgcacctcttttcttagcgcaagctggcaaagatgaaatgattgag
ccaatgggcgtctatcaaacggcccaagcgctaacacaagcacgtgtgaccttacaatgg
tacccaaatagcggacatgtcattacggtgagtggagaacacaaacaattagagcaagat
gtggtgcaatttttagcaacactaccttggaatgaggagaaataa

DBGET integrated database retrieval system