KEGG   Enterococcus faecalis Symbioflor 1: EFS1_2132Help
Entry
EFS1_2132         CDS       T02399                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
efs  Enterococcus faecalis Symbioflor 1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:efs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EFS1_2132
Enzymes [BR:efs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     EFS1_2132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2176186..2178795)
Genome map
AA seq 869 aa AA seqDB search
MVTLFGEDEEKAFIVGTVQAIFFENPSNFYKVVLVNVTDTNTDYLEKEIVVTGSFGQVQE
EEPYRFFGHFVDHPRYGRQFQVDSYQQERPTSASGVVNYLSSDKFPGIGKRTAEKIVEVL
GESAIDRIIDDPSVLEEVTVLNEKKRQVIVETIRLNHGMEQVIVGLNRYGFGSQLAFSIY
QTYQEETLSVIQENPYQLVEDIEGVGFKRADNIAEQIGIQADSAVRIRAAILHEVFEHSI
RSGNTYVQADVLLEEAIRTLEASRPVEISPDQVANEIITLVEHGKIQQEETKLFENSLYF
SEWGIGTSIQRLLSRKKEIHYEEEEVQKNIRMIEKRLNIQYGDSQQAAIEAAIKSPLFIL
TGGPGTGKTTVINGIVSLFAELNGLSLDLKDYTQEMFPILLAAPTGRAAKRMNETTGLPA
STIHRLLGLTGREKNPSLTAKELEGGLLIVDEMSMVDTWLANTLLKAIPTNMQVIFVGDK
DQLPSVGPGQVLHDLLQINEIPKCELNEIYRQGDGSSIIPLAHEIKEGKLPADFQKNQKD
RSFFASDIGHIEEYIRQIVTKAKAKGFTPQDIQVLAPMYRGAAGIDALNKMMQEIFNPNE
GKKKEVKWNDTVYRIGDKVLQLVNTPELNVFNGDMGEIVGITLAKDSEDKVDELVLQFDN
NEVTYKRNEWNKITLSYCCSIHKAQGSEFRMVLLPMVHQYSRMLQRNLLYTAVTRSKELL
ILLGEVSAFETCVKNESASRMTMLKERIVNAEQMTLTTRTQLEAYEEGLTADHPFTEKET
KAVSYETEQQSTKANQIKETDEQLVDTTVQEVSLFADEGEESTPETAKKATKVVEEPLPK
EPRLTVEIIQTNAVDPMIGMKDTTPYQFM
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
gtggtaacactttttggtgaggacgaagaaaaagcctttattgttgggactgtacaagca
atcttttttgaaaatcccagtaatttttataaagtcgttcttgtaaatgtgaccgataca
aatacagattatttagaaaaagaaattgtagtaactggtagttttggccaagttcaagaa
gaggaaccctaccgtttctttggtcattttgtggaccatcctcgttatggcagacagttt
caggtggatagttatcagcaagaaagaccgacttcggctagtggggtggttaactattta
tcaagtgacaaatttcctggcattggtaaacgaactgctgaaaaaattgttgaagtatta
ggggaaagtgcgattgaccgaattattgatgacccgagtgttttggaagaagttactgtt
ttaaatgaaaaaaaacgtcaagtaatcgtcgaaacaattcgcttgaatcacgggatggag
caagtgattgtgggactaaatcgatacggcttcggtagtcagttagctttttcaatttat
caaacctatcaagaagaaaccctttctgtgattcaagaaaatccttatcagttagttgaa
gatattgagggagtcggatttaaacgagcggacaatattgctgaacaaatcggcattcag
gcggattctgctgttcgaattcgagcggcgattttacatgaagtgtttgaacactccatt
cgctcaggcaatacgtatgttcaagcagatgttttattagaagaagcaattcggaccttg
gaagcaagtcgcccagtggaaatctcacctgatcaagtggccaatgaaatcattacgtta
gtcgaacatggaaaaatccaacaagaagagactaaactttttgagaacagtctctatttt
tctgaatggggcattggtacttcgattcagcgtttactttctcgtaaaaaagaaattcat
tatgaggaagaagaagtccaaaaaaatatccgaatgattgagaaacgtttaaatattcag
tatggcgactcgcaacaagcagcgattgaagcagcgattaaatcgccgttatttatttta
actggagggcccggaacagggaaaacaactgttattaatgggattgtctcgttgtttgcg
gaactaaatggtctttcattagatctcaaagactatacgcaggagatgtttccaatcttg
ctagcggcgccaactgggcgagcagctaaacgtatgaacgaaacgacaggtttacctgca
agtaccatccatcgtttgttaggcttgacaggtcgtgaaaaaaatccgagtttaaccgcc
aaagaattagaaggtggtttgctaattgtagatgaaatgtcaatggtggatacttggtta
gccaatacgttattaaaagctattccgacaaacatgcaagtgatttttgttggtgataag
gatcagctaccgtctgtcggtccaggtcaagtcttacatgacttattgcaaattaacgaa
attcccaaatgtgagctaaacgaaatttatcgtcaaggagacggttcaagtattattcct
cttgcccatgaaattaaagaaggaaagttgcctgctgattttcaaaaaaatcaaaaggat
cgctcgttctttgcaagtgatattggtcatattgaagaatacattcgacaaatcgtcaca
aaggcaaaagcaaaagggtttacgccacaagatatccaagttttagcgccaatgtatcgt
ggcgcagctggcattgatgccttgaataagatgatgcaagaaatcttcaatccaaatgag
gggaagaaaaaagaagtcaaatggaatgacaccgtctatcggatcggggacaaagttttg
caactagtcaatacgccagaattaaatgtgttcaatggagatatgggagaaatcgtcgga
attactttagccaaagactcagaggacaaagtggacgagttggttttacagtttgataat
aatgaagtaacgtataaaagaaatgaatggaataaaattacgctatcgtattgttgttcg
attcataaagcgcaaggtagtgaattccgcatggtgttactgccaatggttcatcagtat
agccgaatgctgcaacgaaatttgctgtatacagcagtgacacgtagtaaagaattatta
attctactaggtgaggtttctgcttttgaaacatgtgtcaaaaacgaatcggctagtcgc
atgacgatgctaaaagaacgaatcgtgaacgcagaacaaatgaccttaacgactagaact
cagttagaagcctatgaagaaggtttaacggcagaccatccatttactgaaaaggaaaca
aaagctgtctcttatgaaactgaacagcaatcaacgaaagccaatcagatcaaagaaaca
gacgagcaattagttgacacaacggtacaagaagtttcactatttgctgatgaaggggaa
gagtcaaccccagaaacagcaaagaaagcgacaaaagttgtcgaagaaccattaccaaaa
gaaccacgactaacagtcgaaattattcaaacaaatgctgttgatccaatgattggaatg
aaggatacgacgccttatcaatttatgtga

DBGET integrated database retrieval system