KEGG   Enterococcus faecalis Symbioflor 1: EFS1_2230Help
Entry
EFS1_2230         CDS       T02399                                 

Gene name
recR
Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
efs  Enterococcus faecalis Symbioflor 1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:efs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EFS1_2230 (recR)
DNA repair and recombination proteins [BR:efs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EFS1_2230 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2278822..2279418)
Genome map
AA seq 198 aa AA seqDB search
MNYPEPIAKLIESYMKLPGIGQKTATRLAFYTIDMKEEDANAFAKALISVKRDLHFCSIC
GNITEEDPCEICQDKNRDRSIILVVEEPKDVMAMEKMREYQGLYHVLHGVLSPMEGTGPE
DINIASLIKRLHDDEVKEVIIATNATTEGEATAMYLSRLIKPAGITVTRLAHGLSVGSDI
EYADEITLLKAVEGRREI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaattatccagaaccgattgcaaaattgattgaaagttatatgaaattaccaggaatt
ggtcaaaaaacagcgacacggcttgctttttatacaattgatatgaaagaagaagatgct
aatgcttttgcaaaagcgctaattagtgtcaagagagatctccatttctgtagtatttgc
ggaaatattactgaagaagatccttgtgaaatttgccaagataaaaatcgtgaccgtagt
attattttagtagtggaagaaccaaaagacgttatggcaatggaaaaaatgcgtgaatat
caaggcttgtatcacgtactccacggggtgctttcaccgatggaaggaacaggaccagaa
gatattaatattgcctctttgatcaaacgattgcacgatgatgaagtgaaagaggtcatt
atagcaaccaacgctaccactgaaggagaagcgacggcgatgtatttatcacggctcatt
aaaccagctggaatcaccgttactcgtttggcacacggcttgtctgtcggcagcgatatt
gaatatgcagacgaaataaccttgctaaaagcagtcgaaggacgtcgagaaatttaa

DBGET integrated database retrieval system