KEGG   Enterococcus faecalis Symbioflor 1: EFS1_2251Help
Entry
EFS1_2251         CDS       T02399                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
efs  Enterococcus faecalis Symbioflor 1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:efs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EFS1_2251 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFS1_2251 (glcK)
   00052 Galactose metabolism
    EFS1_2251 (glcK)
   00500 Starch and sucrose metabolism
    EFS1_2251 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    EFS1_2251 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EFS1_2251 (glcK)
   00524 Butirosin and neomycin biosynthesis
    EFS1_2251 (glcK)
Enzymes [BR:efs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EFS1_2251 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2298199..2299170)
Genome map
AA seq 323 aa AA seqDB search
MDKKIIGIDLGGTTIKFAILTTDGVVQQKWSIETNILEDGKHIVPSIIESIRHRIDLYNM
KKEDFVGIGMGTPGSVDIEKGTVVGAYNLNWTTVQPVKEQIESALGIPFALDNDANVAAL
GERWKGAGENNPDVIFITLGTGVGGGIVAAGELLHGVAGCAGEVGHVTVDPNGFDCTCGK
RGCLETVSSATGVVRVARHLSEEFAGDSELKQAIDDGQDVSSKDVFEFAEKGDHFALMVV
DRVCFYLGLATGNLGNTLNPDSVVIGGGVSAAGEFLRSRVEKYFQEFTFPQVRNSTKIKL
AELGNEAGVIGAASLALQFSKEK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggataagaagattattgggattgatttaggtggaacgaccatcaaatttgctatttta
acaaccgatggcgttgttcaacaaaaatggagtattgaaacgaatattttagaagatggc
aagcacattgtgccatcaattattgaaagtattcgtcaccgtatagatctttataatatg
aaaaaagaagattttgtgggaattggtatgggaacaccaggaagtgtcgacattgaaaaa
ggaactgttgtaggtgcctataatttaaactggacgactgtacagcctgtcaaagaacaa
atcgaatctgctttaggaattccgtttgccttagataatgatgccaatgttgccgcttta
ggtgagcgttggaaaggcgcgggggaaaacaatcccgacgtgatttttattactttagga
acaggtgtcggcggaggcattgttgcagcaggagaattactccacggtgttgctggctgt
gctggtgaagttgggcatgtgacggttgatcctaacggctttgactgtacctgtgggaaa
cgtggctgtttagaaactgtttctagtgccactggtgtcgttcgtgttgcacgtcattta
tcagaagagtttgcaggtgactctgaactgaaacaagcgattgatgatggacaagatgtt
tcaagtaaagacgtttttgaatttgccgaaaaaggcgatcattttgctttaatggttgtg
gatcgtgtttgtttctatttaggcttggccacaggaaacttaggtaacacgttaaatcca
gatagcgtggttatcggtggaggtgtttctgcagcaggagaatttttacgtagtcgtgtc
gaaaaatatttccaagaatttactttcccgcaagttcgaaatagtacaaaaatcaaatta
gcagagctaggtaatgaggccggcgtcattggtgccgcttcactagcattacaattttca
aaagagaaatag

DBGET integrated database retrieval system