KEGG   Enterococcus faecium DO: HMPREF0351_10142Help
Entry
HMPREF0351_10142  CDS       T02120                                 

Gene name
ruvA
Definition
crossover junction endoribonuclease subunit A (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
efu  Enterococcus faecium DO
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:efu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF0351_10142 (ruvA)
Enzymes [BR:efu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HMPREF0351_10142 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
140375..140728
Genome map
AA seq 117 aa AA seqDB search
MPLAIMASEDHSGLIQAVESSDVTYLTKFPGVGKKTAQQMILDLKGKFGELSIDTPFSLF
DEANTKDATALSEAMEALSALGYSDREIKRVEKQLKEVDNQTTDEYLRQALKLMMKK
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
gtgcccttggcaatcatggcaagcgaagaccactccggtttgattcaagcagtagaatcc
agtgatgtcacttatttgacgaaatttccaggagtagggaaaaagacagcacaacaaatg
atcttggatctaaaaggaaaattcggtgagctgagtatcgatacaccttttagtctattt
gatgaagcaaacacaaaagacgctacagctctatctgaagcaatggaagctctctcggct
cttggttacagtgatcgagaaatcaaacgtgtagaaaaacaattaaaagaagtagataat
cagacaacggatgagtatctacgccaagcactcaagctaatgatgaaaaaataa

DBGET integrated database retrieval system