KEGG   Enterococcus faecium DO: HMPREF0351_10204Help
Entry
HMPREF0351_10204  CDS       T02120                                 

Gene name
aad
Definition
aldehyde-alcohol dehydrogenase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
efu  Enterococcus faecium DO
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HMPREF0351_10204 (aad)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0351_10204 (aad)
   00620 Pyruvate metabolism
    HMPREF0351_10204 (aad)
   00650 Butanoate metabolism
    HMPREF0351_10204 (aad)
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0351_10204 (aad)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HMPREF0351_10204 (aad)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HMPREF0351_10204 (aad)
   00626 Naphthalene degradation
    HMPREF0351_10204 (aad)
Enzymes [BR:efu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HMPREF0351_10204 (aad)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     HMPREF0351_10204 (aad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
202396..204996
Genome map
AA seq 866 aa AA seqDB search
MMAKVIEKEKTKTIDVQAMIDDLAEKANAALKEMESFDQEKVDHIVHEMAMAALDQHMPL
AKMAVEETGRGVYEDKAIKNMYASEYIWHNIKHDKTVGVINEDVQKGLIEIAEPVGVVCG
VTPTTNPTSTTIFKSMIALKTRNPIVFAFHPSAQKSSAEAARVVRDAAIAAGAPENCIQW
IEHPSIEATSMLMNHPGIAIVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIEKTAKIKR
AVNDLIVSKTFDNGMICASEQAVIVDKEIYAAVKAEFQAHQVYIVKPDELQKLEDAVMNE
GKYAVNPSIVGHSAMEIAKLAGISVPKGTKMLIAELEGVGPDYPLSREKLSPVLAMIKAN
NTDHAFDLCEGMLNLGGLGHTAVIHSENEELHVKFGLRMKACRILVNTPSAEGGIGDIYN
EMIPSLTLGCGSYGKNSVSRNVSAVNLINVKTVAKRRNNMQWFKLPPKIFFEKNSLLYLE
KMENVERVMIVCDPGMVQFGYCDTVREVLARRKNDVKIEVFSDVEPNPSTNTVYAGTKLM
ADFKPDTVIALGGGSAMDAAKGMWMFYEHPDTSFFGAKQKFLDIRKRTYKIDKPEKTQFV
CIPTTSGTGSEVTPFAVITDSETHVKYPLADYALTPDVAIVDPQFVMSVPASVTADTGMD
VLTHAIESYVSVMASDYTRGLSLQAIKLVFDYLEKSVKTPDMESREKMHNASTMAGMAFA
NAFLGICHSVAHKIGGEYGIPHGRTNAILLPHIIRYNAKDPQKHAMFPKYDYFRADTDYA
DIAKFLGLKGETTEELVEALATAVYELGKSVGINMSLKAQGVTQETLDTTVDRMAELAYE
DQCTTANPKEPLISELKQIIIDAYNG
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgatggctaaagtaatagaaaaagaaaaaacgaagacaattgacgtacaagcaatgatt
gatgatttggcagaaaaagcaaatgcagcattgaaagaaatggaaagctttgatcaagaa
aaagtagaccatatcgtgcatgaaatggcaatggcagctttggatcaacatatgccatta
gcgaagatggctgtagaggaaacaggccgcggtgtttacgaagataaagcaatcaaaaat
atgtatgcgtccgaatatatttggcataatatcaaacatgataaaacagttggtgtgatc
aatgaagatgtccaaaaagggttgattgaaattgctgaaccagtcggtgtggtttgcgga
gtaactccaacaacgaatccgacttccacaacgattttcaaatcaatgatcgcgttgaaa
acaagaaatccaatcgtttttgctttccatccaagtgcccaaaaatcttctgcagaagca
gcacgagtggtacgtgatgctgctatcgctgccggagctcctgaaaattgtatccaatgg
atcgaacatccttcgatcgaagcgacttctatgctaatgaaccatccaggtatcgcgatc
gtcttagcgacaggtggagctggaatggtcaagtctgcttactctacaggaaaaccagct
ttaggtgtaggtccaggtaacgtaccagcttatattgaaaaaacagcaaaaattaaacgt
gcagtgaacgatttgatcgtttcgaaaacatttgataatggaatgatttgtgcttctgaa
caagctgtgatcgtggataaagaaatctatgcagcagtaaaagcagaattccaagcacac
caagtttatatcgtaaaaccagatgaattgcaaaaattagaagatgcagtgatgaacgaa
ggaaaatatgcggtcaatccatcaatcgttggacattctgcgatggaaatcgcaaaattg
gcaggaatcagtgtaccaaaaggaacgaaaatgctgattgctgaattggaaggcgtaggc
ccagattatccgctatcaagagaaaaactttctccagttcttgccatgatcaaagctaac
aacacggaccatgcgtttgatttgtgtgaaggtatgttgaatcttggaggattaggacat
acagcagttatccattcagaaaacgaagagttgcatgtcaaattcggtcttcgaatgaaa
gcttgtcgtattttagtgaatacaccatctgcagaaggcggcatcggtgatatctataac
gaaatgattccgtcattgactttgggatgcggttcttatggtaagaactctgtttctcgt
aacgtctctgctgtaaacttaatcaatgtcaaaactgtagcgaaacggagaaataacatg
caatggttcaaattaccgccaaaaatcttctttgaaaagaactctctattgtacttagag
aaaatggaaaacgttgaacgtgtcatgatcgtttgtgaccctggtatggtccaattcggt
tactgcgatacagttcgtgaagtattggcacgacgtaaaaatgatgtgaagatcgaagtc
ttctcagatgttgaaccgaacccatcgacaaataccgtatacgcaggaacgaaactgatg
gcagacttcaagccagatacagtaatcgctcttggaggcggttctgcaatggacgcagct
aagggaatgtggatgttctatgaacacccagacacatctttctttggtgcaaaacaaaaa
ttcttggatatccgtaaacggacatataagatcgacaaaccagaaaaaacacaattcgta
tgtatcccgacaacatcagggactggttctgaagtaacgccatttgcggtcatcactgac
agtgaaacacatgtgaaatatccgttagcagattatgcattgacgccagatgtcgcaatc
gtcgatcctcaattcgtcatgtcagttccagcatctgtcacagcagataccgggatggat
gtgttaacacatgcaatcgaatcctatgtttcagtcatggcttcagattatacacgtgga
ttgagcctacaagcaatcaagttagtctttgactatttagaaaaatcagtaaaaacacct
gatatggaatcacgtgaaaaaatgcacaacgcttctacaatggctggtatggcgtttgct
aacgcattcctaggtatttgtcactcagtcgcacataaaatcggcggggaatacgggatc
cctcatggacggacaaatgcgattcttttaccgcatattatccgctataatgcaaaagat
ccacaaaaacatgcgatgttccctaaatatgactatttccgtgcagatacagattacgca
gatatcgcaaaattcttaggtctgaaaggcgaaacaacagaggaattagtcgaagcttta
gcaacggctgtttatgaattaggaaaatctgtcggcatcaacatgagtctaaaagctcaa
ggagtcacacaagaaacactagatacaaccgtagaccgtatggctgaattagcttacgaa
gaccaatgtacgacagctaatccgaaagaaccattgatctctgaattgaaacagatcatc
attgatgcttacaacggataa

DBGET integrated database retrieval system