KEGG   Enterococcus faecium DO: HMPREF0351_10380Help
Entry
HMPREF0351_10380  CDS       T02120                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efu  Enterococcus faecium DO
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:efu00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
363103..364560
Genome map
AA seq 485 aa AA seqDB search
MKKFPEGFLWGGATAANQCEGAWDVDEKGLSVSDVYTFDSDLPKEKWTDQWHMMTHQQVK
AAQDPNSKYYYPKRHGNDFYHHFKEDIRLFAEMGFKCYRMSIAWTRIFPHGDEETPNEAG
LFFYDQVFDECLKYGIEPVVSLSHYEMPLYLVTEYGGWPNRKLIQFYVRFAETVFKRYKN
KVKYWMTFNEINCVKHHPFVSVGVIEENHPHLEQAKYQGAHHQFIASALATKACHEIIKG
SQVGCMISYQLLVPYSCDPDDIQKTIEQQRTSLFFSDVQARGYYPAYTQRMFEEKGVNLK
IEVGDEEILAAYPVDFVSFSYYMSSAVSAHPENWEGVQGNLITGGIKNPYLPSSEWGWQI
DPKGLRIALNQLYDRYQKPLFIAENGLGAIDKVEEDGTVQDDYRIDYLKQHIEQMKEAIK
DGVDLFGYTSWGCIDIVSASTSQMSKRYGYIYVDQDDEGNGTKKRLKKKSFDWYRQVIQS
NGEIL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttccagaaggatttttatggggcggagcgacagcggccaatcaatgtgaa
ggtgcatgggatgtagatgaaaaaggattatctgtgtctgatgtgtatacattcgacagc
gatttacctaaagaaaaatggacagatcaatggcatatgatgacgcatcagcaagtaaaa
gcggcgcaggatcccaacagcaagtattattatcctaaaagacacggaaatgatttctat
catcactttaaagaagacatccgtttatttgctgaaatgggttttaaatgctatcggatg
tctatcgcatggacaagaatttttcctcatggtgatgaagaaacacccaatgaagcggga
ttatttttttatgatcaagtgtttgacgaatgtctaaaatatgggattgagccagtcgtt
tctctttcccattatgaaatgccgttatatttggttacagaatatggtggatggcctaat
cgaaagcttattcagttttacgttcgtttcgctgaaacagtattcaaacgctataaaaat
aaagtaaaatattggatgactttcaatgagatcaactgtgtaaaacatcacccttttgtt
agcgtaggagtaattgaagaaaaccatccccatttggaacaagcgaaataccaaggtgca
caccatcagtttatagcaagtgctttagctacaaaagcttgtcatgaaattatcaaaggt
tcacaagtcggttgtatgatcagctatcagcttcttgttccgtattcttgtgatccggat
gatattcaaaaaacaattgagcagcaaagaacttctttgttctttagtgatgttcaagca
agaggatattatccagcgtatacgcaacgaatgtttgaagaaaaaggtgtcaacttaaaa
atagaagtaggtgatgaagaaatcttagcagcctaccctgttgattttgtttcttttagc
tactacatgtctagtgcagtcagtgctcatccagaaaattgggaaggggtccaaggaaac
ttaataactggaggaattaaaaatccgtatcttccatcaagtgaatggggctggcagatt
gatcctaagggtttgagaattgctttgaatcaattatatgataggtatcaaaaaccactg
ttcatagctgaaaacggactcggagctatagacaaagtagaagaagatggaaccgttcaa
gacgattaccgcattgactatttgaagcagcatattgagcagatgaaggaagctatcaaa
gatggagtagatttatttggttatacgtcgtggggctgcattgatatcgtcagcgcttct
acttcacaaatgtcaaaacgttatggatatatctatgttgatcaagatgacgaagggaat
ggcacaaagaaacggttaaagaaaaaatcatttgattggtacagacaagtcatccaatca
aatggcgaaatcctataa

DBGET integrated database retrieval system