KEGG   Enterococcus faecium DO: HMPREF0351_10386Help
Entry
HMPREF0351_10386  CDS       T02120                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
efu  Enterococcus faecium DO
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:efu00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
370675..371886
Genome map
AA seq 403 aa AA seqDB search
MEGITMTESTYIMAIDQGTTSSRAIIFDKKGRHIGSSQKEFTQYFPQESWVEHDANEIWN
SVQSVIAGAFIESGIKPNQIAGIGITNQRETTVIWEKDTGRPIYHAVVWQSRQSAGIADN
LKNEGYQEFFHEKTGLVIDAYFSATKIRWILDHVEGAQERAEKGELMFGTIDSWLVWKLT
DGQAHVTDYSNASRTMLFNIHQLDWDQEILDLLNIPRVMLPKVTSNSEVYGYTQGYHFYG
SEAPISGMAGDQQAALFGQMAFEPGMVKNTYGTGSFIVMNTGEKPQLSKNNLLTTIGYGI
NGKVYYALEGSIFVAGSSIQWLRDGLQMLQKASDSEDAAKRSTSEDEVYVVPAFVGLGAP
YWDQAARGAMFGLTRGTTKEDIIKATLQSIAYQVRDIHRYDAR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggagggaatcacaatgacagaatcaacgtatatcatggcgattgaccaaggtacaact
agctcacgagcaattatctttgacaagaaaggaagacacatcggcagttctcaaaaagag
ttcacgcaatatttcccgcaagaaagttgggtggaacatgatgcaaatgaaatctggaat
tctgtacagtcagttattgccggagcgttcatcgaatcagggatcaaaccaaatcagatt
gctgggattggcataacgaaccagcgtgaaacaacagtaatatgggaaaaagatacagga
cgtccaatctatcatgcagttgtttggcaatccagacagtcagctggaattgcagataac
ttaaaaaatgaaggctatcaagaatttttccacgaaaaaacagggttagtgatcgatgcc
tatttctcagcaacgaagatacgctggattcttgatcatgtagaaggcgcgcaagaacga
gctgaaaaaggcgaattgatgtttggaacgatcgattcttggttagtatggaaactgacc
gatggacaagcacatgttactgattactcgaatgccagtcggacgatgttgttcaatatc
catcagctagattgggatcaggagattttagatttactaaatattcctcgagtgatgtta
ccaaaagtcacttctaactcagaagtttatggttatacgcaaggttatcatttttatgga
agcgaagcaccaatttcagggatggcaggagaccagcaagccgcattattcggacaaatg
gcattcgaaccaggcatggtcaagaatacttatggtacaggttcatttattgtcatgaat
accggtgaaaaaccgcaattatccaaaaataatttattgacgacaattggttacggcata
aatggaaaggtttactatgctttagaaggaagtatttttgtggctggttcttcgattcaa
tggctgagagatggacttcaaatgttgcaaaaagctagcgattcagaagacgcagcgaaa
cgctctacaagcgaagatgaggtttatgttgttcctgcattcgttgggctaggtgctcct
tattgggatcaggcagcacgaggggctatgtttggcttgacacgtggtacgacaaaagaa
gatatcattaaagctactttacagtcgattgcttatcaagtgagagatatccatcgatac
gatgcaagatga

DBGET integrated database retrieval system