KEGG   Enterococcus faecium DO: HMPREF0351_10491Help
Entry
HMPREF0351_10491  CDS       T02120                                 

Gene name
galM3
Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
efu  Enterococcus faecium DO
Pathway
efu00010  Glycolysis / Gluconeogenesis
efu00052  Galactose metabolism
efu01100  Metabolic pathways
efu01110  Biosynthesis of secondary metabolites
efu01120  Microbial metabolism in diverse environments
efu01130  Biosynthesis of antibiotics
Module
efu_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0351_10491 (galM3)
   00052 Galactose metabolism
    HMPREF0351_10491 (galM3)
Enzymes [BR:efu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     HMPREF0351_10491 (galM3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 12999154
NCBI-ProteinID: YP_006375097
UniProt: Q3Y291
Position
complement(488800..489831)
Genome map
AA seq 343 aa AA seqDB search
MKITEKDFGQGYHLITLENKNKLALSISDLGARIVSLKSNDRELVLGFDTAEEYIEKDPY
IGASIGRTAGRIENGRFSLNGKTYQLATDPKTGHNLHGGAPGFELKKWSYVILNGENEAS
VIFTTTSPDGEHGFPGTMDVEIRYTLTKDNIWRVTSRGTSDQDTLFNPTNHVYFNLTGDA
SQSIDQHELWLNSEAYAPLRTDSIPIGVKENAAGSAFDFQIPKKLASVFASDLDQKNLVD
GIDHPFFLKETGLGKEAARLTSPDKRIQVDIATDASSVVIFTANFGTETPEMRNRKLAHH
GGITFETQTAPGAERFSAFGSIHLKAGSVFETVTEFKIKTRKE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaagattacagaaaaagattttggccaaggttatcacttgataaccttggagaacaaa
aacaagctagcactttctatctctgatttaggtgctagaatcgtcagtttaaaatcaaat
gatcgagaattagttttgggatttgacaccgctgaagaatatatcgaaaaagatccgtat
atcggtgcttctatcggtcgcaccgcagggagaatcgaaaatggccgcttttctctcaat
ggaaaaacttaccaattagccacagatccaaaaactggacataatctgcatggtggtgct
cctggatttgaattaaaaaaatggtcttatgtcattttgaatggcgaaaatgaagcttct
gtcatttttactactacaagtcccgacggagaacatggttttccaggtacaatggatgtg
gaaatccgctatactttgacaaaagataatatctggcgagtgacctctcgcggcaccagt
gaccaagatactttattcaatccgacaaatcatgtttacttcaacttgacgggagatgct
tctcagtcaatcgatcaacatgagctttggctcaatagcgaagcttatgctcctttgcga
acagatagtattcctataggggtaaaagaaaatgctgcaggaagtgctttcgattttcaa
atacctaaaaaattagcgtccgtttttgctagtgatttggatcaaaaaaatcttgttgac
ggaatcgatcatccatttttcttaaaagaaaccggcttgggtaaagaagccgctcgcttg
actagccccgataaaagaatccaagtagatattgctacagatgcttctagtgtggttatt
ttcactgcaaatttcggcacagaaacaccagaaatgcgcaaccgaaaactggcacatcac
ggtggcatcacatttgagactcaaacagctccaggtgcagagcgcttctcagcatttggt
tcgattcatttaaaagccggatcagtatttgaaacagtaacagaattcaaaatcaaaaca
agaaaggaataa

DBGET integrated database retrieval system