KEGG   Enterococcus faecium DO: HMPREF0351_10722Help
Entry
HMPREF0351_10722  CDS       T02120                                 

Gene name
murAB
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
efu  Enterococcus faecium DO
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0351_10722 (murAB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF0351_10722 (murAB)
Enzymes [BR:efu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     HMPREF0351_10722 (murAB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
726329..727600
Genome map
AA seq 423 aa AA seqDB search
MKKIVIKGNRPLAGEVTISGAKNSAVALIPAAILADSPVILEGVPDIQDVHSLIEILEIM
GATVHFSNNILEIDPREVVSIPMPHGKINSLRASYYFMGTLLGKFGEAVVGLPGGCYLGP
RPIDLHVKGFEALGAEVTNEHGAMYLRTENKGLRGNRIFMDVVSVGATINVMLAAVKAKG
QTVIENAAREPEIIDVATLLNNMGAKVRGAGTDVIRIEGVETLHGCRHFMIPDRIEAGTY
LALAAAVGNGIKVKNVIFEHLESFIAKLQEIGVHMKISEDEIEVYPSKELKPANIMTYPY
PGFATDLQQPLTALLLMTTGTSEIIDTIYAKRVNHVPELARMGADITVEGNMIIVNGPNK
LHGTEVVASDLRAGACLVIAGLLAEGTTTIYNVDYILRGYDHIIEKLTALGASIEMIEEV
GAE
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcgtaatcaaaggaaaccgacctttagctggtgaagtaacgatcagcggt
gcaaaaaatagtgcagtcgcattgattccagctgcaatcttagctgattccccagtgatc
ttggaaggtgtgccggacatacaagatgttcattcattaattgaaattttagagatcatg
ggcgcaactgtccatttttccaacaacatactagaaatcgatcctcgagaagtcgtatcg
attccgatgccgcacggaaaaatcaatagtttgcgtgcttcttattattttatgggaaca
ctgcttggtaaatttggcgaagcggtagtaggcctgccaggtggctgttatttaggccct
agaccgattgacctacacgtcaaaggatttgaagctctaggtgctgaagtgacaaatgaa
catggtgccatgtatttacggacagaaaataaaggattgcgtggcaatcggattttcatg
gacgtggtttcagtcggagcaacgatcaatgtgatgttagctgctgtaaaagcaaaagga
cagacagtaattgaaaacgctgcacgagaaccggaaatcatagatgtggcaactttactg
aataatatgggggcaaaagttcgaggagcgggtacagatgtgatccgtatcgaaggagtc
gaaacattacatggctgtcggcatttcatgattcctgaccgcatcgaagcaggaacctat
ctagcattagcagctgcagtaggaaatggtatcaaagtgaaaaatgtgatctttgaacat
ttggaaagctttatagcaaaattgcaggaaattggtgtccatatgaaaatcagcgaagat
gaaatcgaagtttacccctcgaaagaattaaaacccgcaaacatcatgacctatccttat
ccaggatttgccacagatctgcagcagccacttactgcgttactattgatgactacaggc
acttcagaaatcatcgatacgatctatgcgaaacgtgtgaaccatgtgccggaactagca
cgaatgggcgctgatattaccgtggaaggaaatatgatcatcgtgaatggtccaaataaa
cttcacggcacagaagtcgtggcttctgatcttcgggcaggtgcttgtttagtgattgct
ggactattggcagaagggacaacgacgatttacaatgtagattatatcttacgcggttat
gatcatattatcgagaaactaacagccttaggggcatcaattgaaatgatagaggaagtg
ggagctgaatga

DBGET integrated database retrieval system