KEGG   Enterococcus faecium DO: HMPREF0351_11001Help
Entry
HMPREF0351_11001  CDS       T02120                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
efu  Enterococcus faecium DO
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:efu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:efu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:efu00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:efu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:efu00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:efu00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:efu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
981289..982260
Genome map
AA seq 323 aa AA seqDB search
MFIMKRIGILTSGGDAPGMNAAVRAVVRKGIYEGLEVYGINYGFAGLVAGDIRRLDVADV
GDKIQRGGTFLYSARYPEFATEEGQLKGIEQLKKFGIEGLVVIGGDGSYHGAMALTKRGF
PAVGIPGTIDNDIPGTDFTIGFDTAINTVLESIDRIRDTATSHVRTFVIEVMGRNAGDIA
LWSGVAGGADEIIIPEHDFDMASVAKKIQEGRDRGKKHCLIILAEGVMGGNEFAEKLSEF
GDYHTRVSILGHVVRGGAPSARDRVLASKFGAYAVELLQEGKGGLCVGIHDNEIVASDII
DTLENNKHKPDLSLYDLNNSLSF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtttattatgaaacgcatcggaattttgaccagtggcggagacgcacctggaatgaat
gcagctgttcgtgccgttgttcgtaaaggtatttacgaaggactggaagtatacgggatc
aattatggttttgccggtttagttgctggagatattcgtcgtcttgatgtggcagatgta
ggtgacaagatccaacgtggtggtacattcttgtattctgcacgttatccagaatttgca
actgaagaaggtcaattaaaaggaatcgaacaattgaaaaaattcggaatcgaaggtcta
gtggttatcggaggagacggctcttatcatggcgcaatggctttgacaaaacgcggtttc
ccagcagtaggtattcctggaacaatcgataatgatattcctgggactgatttcacaatc
ggttttgatacagcaatcaatacagtactagaatcaattgaccgtattcgtgacacagcg
acttctcatgttcgtacattcgttatcgaagtaatgggacgcaatgcaggagacatcgct
ttatggtcaggtgtggctggcggagcggatgaaatcatcatcccagaacatgattttgat
atggcttcagttgctaaaaaaatccaagaaggccgcgatcgcgggaagaaacattgcttg
atcatcttggctgaaggtgtaatgggcggaaatgaattcgctgagaaactttcagaattt
ggtgactatcatacacgtgtatctatcttgggacacgttgtccgtggtggagcaccaagc
gcacgcgaccgcgtgttggcaagtaaattcggtgcttacgctgtcgaattgcttcaagaa
ggaaaaggtggattatgtgtcggtatccatgacaacgaaatcgttgcgtctgacatcatt
gatacacttgaaaacaacaaacataaaccagacttatcactatatgatctaaataattca
ctttcattttaa

DBGET integrated database retrieval system