KEGG   Enterococcus faecium DO: HMPREF0351_11001Help
Entry
HMPREF0351_11001  CDS       T02120                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
efu  Enterococcus faecium DO
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0351_11001 (pfkA)
   01230 Biosynthesis of amino acids
    HMPREF0351_11001 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0351_11001 (pfkA)
   00030 Pentose phosphate pathway
    HMPREF0351_11001 (pfkA)
   00051 Fructose and mannose metabolism
    HMPREF0351_11001 (pfkA)
   00052 Galactose metabolism
    HMPREF0351_11001 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0351_11001 (pfkA)
Enzymes [BR:efu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF0351_11001 (pfkA)
Protein phosphatases and associated proteins [BR:efu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HMPREF0351_11001 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
981289..982260
Genome map
AA seq 323 aa AA seqDB search
MFIMKRIGILTSGGDAPGMNAAVRAVVRKGIYEGLEVYGINYGFAGLVAGDIRRLDVADV
GDKIQRGGTFLYSARYPEFATEEGQLKGIEQLKKFGIEGLVVIGGDGSYHGAMALTKRGF
PAVGIPGTIDNDIPGTDFTIGFDTAINTVLESIDRIRDTATSHVRTFVIEVMGRNAGDIA
LWSGVAGGADEIIIPEHDFDMASVAKKIQEGRDRGKKHCLIILAEGVMGGNEFAEKLSEF
GDYHTRVSILGHVVRGGAPSARDRVLASKFGAYAVELLQEGKGGLCVGIHDNEIVASDII
DTLENNKHKPDLSLYDLNNSLSF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtttattatgaaacgcatcggaattttgaccagtggcggagacgcacctggaatgaat
gcagctgttcgtgccgttgttcgtaaaggtatttacgaaggactggaagtatacgggatc
aattatggttttgccggtttagttgctggagatattcgtcgtcttgatgtggcagatgta
ggtgacaagatccaacgtggtggtacattcttgtattctgcacgttatccagaatttgca
actgaagaaggtcaattaaaaggaatcgaacaattgaaaaaattcggaatcgaaggtcta
gtggttatcggaggagacggctcttatcatggcgcaatggctttgacaaaacgcggtttc
ccagcagtaggtattcctggaacaatcgataatgatattcctgggactgatttcacaatc
ggttttgatacagcaatcaatacagtactagaatcaattgaccgtattcgtgacacagcg
acttctcatgttcgtacattcgttatcgaagtaatgggacgcaatgcaggagacatcgct
ttatggtcaggtgtggctggcggagcggatgaaatcatcatcccagaacatgattttgat
atggcttcagttgctaaaaaaatccaagaaggccgcgatcgcgggaagaaacattgcttg
atcatcttggctgaaggtgtaatgggcggaaatgaattcgctgagaaactttcagaattt
ggtgactatcatacacgtgtatctatcttgggacacgttgtccgtggtggagcaccaagc
gcacgcgaccgcgtgttggcaagtaaattcggtgcttacgctgtcgaattgcttcaagaa
ggaaaaggtggattatgtgtcggtatccatgacaacgaaatcgttgcgtctgacatcatt
gatacacttgaaaacaacaaacataaaccagacttatcactatatgatctaaataattca
ctttcattttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system