KEGG   Enterococcus faecium DO: HMPREF0351_11001Help
Entry
HMPREF0351_11001  CDS       T02120                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
efu  Enterococcus faecium DO
Pathway
efu00010  Glycolysis / Gluconeogenesis
efu00030  Pentose phosphate pathway
efu00051  Fructose and mannose metabolism
efu00052  Galactose metabolism
efu00680  Methane metabolism
efu01100  Metabolic pathways
efu01110  Biosynthesis of secondary metabolites
efu01120  Microbial metabolism in diverse environments
efu01130  Biosynthesis of antibiotics
efu01200  Carbon metabolism
efu01230  Biosynthesis of amino acids
efu03018  RNA degradation
Module
efu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0351_11001 (pfkA)
   00030 Pentose phosphate pathway
    HMPREF0351_11001 (pfkA)
   00051 Fructose and mannose metabolism
    HMPREF0351_11001 (pfkA)
   00052 Galactose metabolism
    HMPREF0351_11001 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0351_11001 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HMPREF0351_11001 (pfkA)
Enzymes [BR:efu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF0351_11001 (pfkA)
Protein phosphatases and associated proteins [BR:efu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HMPREF0351_11001 (pfkA)
Messenger RNA biogenesis [BR:efu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HMPREF0351_11001 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 12999667
NCBI-ProteinID: YP_006375607
UniProt: I3U0T7
Position
981289..982260
Genome map
AA seq 323 aa AA seqDB search
MFIMKRIGILTSGGDAPGMNAAVRAVVRKGIYEGLEVYGINYGFAGLVAGDIRRLDVADV
GDKIQRGGTFLYSARYPEFATEEGQLKGIEQLKKFGIEGLVVIGGDGSYHGAMALTKRGF
PAVGIPGTIDNDIPGTDFTIGFDTAINTVLESIDRIRDTATSHVRTFVIEVMGRNAGDIA
LWSGVAGGADEIIIPEHDFDMASVAKKIQEGRDRGKKHCLIILAEGVMGGNEFAEKLSEF
GDYHTRVSILGHVVRGGAPSARDRVLASKFGAYAVELLQEGKGGLCVGIHDNEIVASDII
DTLENNKHKPDLSLYDLNNSLSF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtttattatgaaacgcatcggaattttgaccagtggcggagacgcacctggaatgaat
gcagctgttcgtgccgttgttcgtaaaggtatttacgaaggactggaagtatacgggatc
aattatggttttgccggtttagttgctggagatattcgtcgtcttgatgtggcagatgta
ggtgacaagatccaacgtggtggtacattcttgtattctgcacgttatccagaatttgca
actgaagaaggtcaattaaaaggaatcgaacaattgaaaaaattcggaatcgaaggtcta
gtggttatcggaggagacggctcttatcatggcgcaatggctttgacaaaacgcggtttc
ccagcagtaggtattcctggaacaatcgataatgatattcctgggactgatttcacaatc
ggttttgatacagcaatcaatacagtactagaatcaattgaccgtattcgtgacacagcg
acttctcatgttcgtacattcgttatcgaagtaatgggacgcaatgcaggagacatcgct
ttatggtcaggtgtggctggcggagcggatgaaatcatcatcccagaacatgattttgat
atggcttcagttgctaaaaaaatccaagaaggccgcgatcgcgggaagaaacattgcttg
atcatcttggctgaaggtgtaatgggcggaaatgaattcgctgagaaactttcagaattt
ggtgactatcatacacgtgtatctatcttgggacacgttgtccgtggtggagcaccaagc
gcacgcgaccgcgtgttggcaagtaaattcggtgcttacgctgtcgaattgcttcaagaa
ggaaaaggtggattatgtgtcggtatccatgacaacgaaatcgttgcgtctgacatcatt
gatacacttgaaaacaacaaacataaaccagacttatcactatatgatctaaataattca
ctttcattttaa

DBGET integrated database retrieval system