KEGG   Enterococcus faecium DO: HMPREF0351_11055Help
Entry
HMPREF0351_11055  CDS       T02120                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
efu  Enterococcus faecium DO
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HMPREF0351_11055
Enzymes [BR:efu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HMPREF0351_11055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1039863..1040615
Genome map
AA seq 250 aa AA seqDB search
MSDGRMLFERERQDMARIVRVIFERKNTNVAGGNFSFKTTDDQGKDYIIMTPTMMSEAYL
GEISPAQVLVVEPRTRRIVDGVGHLTREINMHEAMYETNPAIKAVLHAHAPNAMFWATTG
LPMPNLTEATAKVKEIPVMDFEPNCSEELAELTSDYVKKQHLELPHMLLLNSHGVLINTG
GESGIEAIHKALQILDTVEWNAEIAYKQTIFQALGITDGFYSKGEKIGGLEELKHKTAIY
NKSVIAAGGD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatggacgtatgttatttgagagagaacgacaggacatggcacgtatcgtaaga
gtgattttcgaaaggaaaaacacaaatgtcgcaggagggaatttttcctttaaaaccact
gatgatcaagggaaagactacatcatcatgacgccgaccatgatgtcagaagcctatcta
ggagagatttctcctgcacaggttctagtagtagaaccaagaacgcgtagaatcgttgac
ggagtcggtcatttaactcgtgaaatcaatatgcatgaagcgatgtatgagactaatcca
gctatcaaagctgtcctacatgctcatgcgcctaatgcaatgttctgggcgactactggg
ttgcctatgcctaatttgacagaagccacagctaaagtaaaagagattcctgtcatggac
tttgagcctaattgctctgaagaacttgctgaattgacaagcgactatgtaaaaaaacag
catctcgaattaccgcatatgttgctgctcaactctcatggcgtattgatcaacacaggt
ggagaatcaggaatcgaagctatccataaagcactgcaaatccttgatacagttgaatgg
aatgcagaaattgcctacaagcagacgatttttcaagcattagggattactgacggtttt
tattcaaaaggtgagaaaatcgggggattggaagagttgaaacataaaacggctatttat
aataaatctgttattgcagctggtggagactaa

DBGET integrated database retrieval system