KEGG   Enterococcus faecium DO: HMPREF0351_11227Help
Entry
HMPREF0351_11227  CDS       T02120                                 

Gene name
aceF
Definition
(RefSeq) pyruvate dehydrogenase complex E2 component dihydrolipoyllysine-residue acetyltransferase subunit
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
efu  Enterococcus faecium DO
Pathway
efu00010  Glycolysis / Gluconeogenesis
efu00020  Citrate cycle (TCA cycle)
efu00620  Pyruvate metabolism
efu01100  Metabolic pathways
efu01110  Biosynthesis of secondary metabolites
efu01120  Microbial metabolism in diverse environments
efu01130  Biosynthesis of antibiotics
efu01200  Carbon metabolism
Module
efu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0351_11227 (aceF)
   00020 Citrate cycle (TCA cycle)
    HMPREF0351_11227 (aceF)
   00620 Pyruvate metabolism
    HMPREF0351_11227 (aceF)
Enzymes [BR:efu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HMPREF0351_11227 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 GCV_H HlyD_D23
Motif
Other DBs
NCBI-GeneID: 12999914
NCBI-ProteinID: YP_006375833
UniProt: Q3XWN7
Position
1213951..1215594
Genome map
AA seq 547 aa AA seqDB search
MAYQFKLPDIGEGIAEGEIVKWFVKPGDTINEDDTLLEVQNDKSVEEIPSPVTGTVKNVI
VPEGTVANVGDVLVEIDAPGHEDNEGDSGVAAESQTPAKPAAEPTVDTESAGSSSEGVFQ
FKLPDIGEGIAEGEIVKWFVKPGDTINEDDTLLEVQNDKSVEEIPSPVTGTVKNVIVPEG
TVANVGDVLVEIDAPGHNSAPSTSAPSAEAPKEKVETSGSASVVEAADPNKRVLAMPSVR
QFAREKDVDISQVTATGKGGRVTKEDIENFLAGGPSSAPAKSEAPEAAAPKEAAPAAESK
PAAPAKPFKSNLGDLEERVAMTPTRKAIAKAMVNSKHTAPHVTLHDEVEVSKLWDNRKRF
KEVAAANGTKLTFLPYVVKALTATVKKYPVLNASIDDANQEIVYKHYYNIGIATDTDHGL
YVPNVKDADRKGMFAIADEINEKAKLAHDGKLSAEDMRNGTITISNIGSVGGGWFTPVIN
YPEVAILGVGTIAQQPIVNAEGEIVVGRVMKLSLSFDHRIVDGATAQQAMNNIKRLLADP
ELLMMEG
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcaatttaaattgccggatatcggtgaaggaatcgcagaaggtgaaatcgtc
aaatggttcgtcaaaccaggagatacgatcaatgaagatgatacattactagaagttcaa
aatgacaaatcagtagaagaaatcccgtcacctgttacaggaacggttaaaaatgtgatt
gttccagaaggtaccgtagcaaatgttggggatgtattagtagaaatcgatgcaccagga
cacgaagacaatgaaggggacagtggtgtagccgcagaatcccaaactccagctaaaccg
gctgctgaacccactgttgatacagaatcagctggatcgtcaagcgaaggagtcttccaa
tttaagttaccggatatcggtgaaggaatcgcagaaggtgaaatcgtcaaatggttcgtc
aaaccaggagatacgatcaatgaagatgatacattactagaagttcaaaatgacaaatca
gtagaagaaattccgtcacctgtcacagggacagttaaaaacgtgattgttccagaaggc
actgtagcaaatgttggggatgtattagtagaaatcgatgctcctggacacaatagtgca
ccgtcaactagtgcgccatcagctgaagcaccaaaagaaaaagtggaaacatcaggttca
gcaagtgtcgttgaagctgccgatccaaataaacgtgtattggctatgccatctgttcgt
caatttgcccgtgaaaaagatgtagatatctcacaagtaactgcaactggaaaaggtggc
agagtaacaaaagaggacatcgaaaacttcttggcaggtggtccaagcagtgcaccagcg
aaatcagaagcgccagaagcggcagcaccgaaagaagcagctcctgcagcagaaagcaaa
ccagctgcaccagcaaaaccattcaagtccaacttaggagacttggaagaacgtgtagca
atgacgccaacacgtaaagctatcgctaaagcaatggtcaacagtaagcatacagctcca
cacgtgacattgcatgatgaagtagaagtgtctaaactatgggataatcggaaacgattt
aaagaagttgctgctgcaaatggtacgaaacttactttcttgccatatgtcgtgaaagct
ttaacagcgactgttaagaaatacccagtattgaatgcatctatcgacgatgcaaaccaa
gaaatcgtttataaacattactacaatatcggtattgcaactgatacggatcacggacta
tatgtaccaaatgtgaaagatgcagaccgcaaaggaatgtttgctattgcagacgaaatc
aatgagaaagcaaaattagctcatgacggcaaactatctgcagaagatatgcgcaatgga
acaattacgatcagcaatatcggatctgtaggtggcggttggtttacaccagtcatcaac
tatccagaagtagctattttaggtgtaggaacgattgcacaacaaccaatcgtaaatgct
gaaggcgaaatcgttgtcggtcgtgtgatgaaactgtcattaagtttcgatcaccgtatc
gtagatggagcaactgcgcaacaagcaatgaataatatcaaacgtcttttagctgatcca
gagctattaatgatggaaggatga

DBGET integrated database retrieval system