KEGG   Enterococcus faecium DO: HMPREF0351_11424Help
Entry
HMPREF0351_11424  CDS       T02120                                 

Gene name
kdpA
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
efu  Enterococcus faecium DO
Pathway
efu00230  Purine metabolism
efu01100  Metabolic pathways
Module
efu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HMPREF0351_11424 (kdpA)
Enzymes [BR:efu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HMPREF0351_11424 (kdpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_23 AAA_21 AAA_16 RNA_helicase ABC_tran AAA_22 dNK AAA_29 AAA AAA_15 RsgA_GTPase ADK Roc IstB_IS21 AAA_24 AAA_28 SPOUT_MTase_2 Gtr1_RagA SMC_N PduV-EutP
Motif
Other DBs
NCBI-GeneID: 13000114
NCBI-ProteinID: YP_006376030
UniProt: Q3XXV5
Position
1412412..1412960
Genome map
AA seq 182 aa AA seqDB search
MNYCYVFIGPSGSGKTSLAEAIFQPEQKIITYTNRSPRPGEKDQEDYYFVSDNTFNQMIK
GNEFAEWDQYAQHKYGSSKAEIKKKLTVGNCYAVLTANGFWHLYEYFGTVVRPIFITISK
ETLQSRLKKRGDSSEQISARLAVYVEDLAQLKRLKAIPSLLVVSNDGAFQEAADKIKKGL
LI
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaattattgctatgtatttatcggtccttctggttctggaaaaacttcactcgcagaa
gctatttttcagccggaacaaaagatcattacttacacgaatcgatcaccaagacctggg
gaaaaagatcaagaggattattattttgtttctgacaatacattcaatcagatgatcaag
ggaaatgagtttgcagagtgggaccaatatgctcaacataaatatggttccagtaaagca
gaaattaaaaagaaactgacagtaggaaattgttacgccgttttgacagcaaatggtttt
tggcatttatatgagtatttcgggacggtagtccgtcctatctttattacgatctctaaa
gaaacattgcaatcgcgcctgaaaaaacgtggagattcatctgaacagatttcagccaga
ctggcggtttatgtagaagatttagcacagttgaaacgtttgaaagctatcccctcactt
ttagtcgtgtcaaacgatggagcgttccaagaagctgcagataaaataaaaaaaggatta
ttgatataa

DBGET integrated database retrieval system