KEGG   Enterococcus faecium DO: HMPREF0351_11575Help
Entry
HMPREF0351_11575  CDS       T02120                                 

Gene name
gpmA3
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
efu  Enterococcus faecium DO
Pathway
efu00010  Glycolysis / Gluconeogenesis
efu00260  Glycine, serine and threonine metabolism
efu00680  Methane metabolism
efu01100  Metabolic pathways
efu01110  Biosynthesis of secondary metabolites
efu01120  Microbial metabolism in diverse environments
efu01130  Biosynthesis of antibiotics
efu01200  Carbon metabolism
efu01230  Biosynthesis of amino acids
Module
efu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
efu_M00002  Glycolysis, core module involving three-carbon compounds
efu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0351_11575 (gpmA3)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0351_11575 (gpmA3)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0351_11575 (gpmA3)
Enzymes [BR:efu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF0351_11575 (gpmA3)
Membrane trafficking [BR:efu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HMPREF0351_11575 (gpmA3)
Exosome [BR:efu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF0351_11575 (gpmA3)
  Exosomal proteins of melanoma cells
   HMPREF0351_11575 (gpmA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 13000266
NCBI-ProteinID: YP_006376181
UniProt: I3U2G1
Position
complement(1546715..1547383)
Genome map
AA seq 222 aa AA seqDB search
MKLVLLRHGESEANFENYWTGWLDVALTEKGKEQAAVAGQKMLEAGLQFDAVYTSVLKRA
ILTGQVALEEMGQLWLPIIKTWRLNERHYGDLVGKNKDKMKEIYGKDQVKTWRRGYTEVP
PLTAENRFDRRYDHLDPHLIPYGESLEMTVNRIIPLWQDHLAPKLKDRQDLLVVGHGNSI
RALTKYLEDVPEDQMDTIDIPNAQPIQYTLADDLTILDKKIL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtattattacgtcatggcgaaagcgaagcaaattttgaaaattactggaca
ggatggctagatgtcgccttaacagaaaaaggaaaagaacaagcagcagttgccggtcaa
aaaatgcttgaagccggacttcaattcgatgccgtttatacctctgttttgaaacgtgcg
attcttaccggacaagtcgcactagaagaaatgggtcagttatggcttcctataataaaa
acatggcgtctaaatgaacggcattatggggatcttgtgggtaaaaacaaagataagatg
aaagaaatatacggaaaagatcaagtaaaaacatggcgcagaggatatacggaagttccg
ccgttaaccgcagaaaatagatttgaccgcagatatgatcacttggatccgcatttgatc
ccatacggagaaagtctggaaatgacagtgaatcggatcattcccttatggcaagatcat
ctagcaccaaaactaaaagatcggcaagatttactagttgtgggtcatggtaatagcatc
cgagcactgacaaaatatttagaagatgttcctgaagatcaaatggatacgatcgatatc
ccaaatgcacaaccaatccagtatacattagcagatgatttgacaattctggacaaaaaa
atactttaa

DBGET integrated database retrieval system