KEGG   Enterococcus faecium DO: HMPREF0351_11575Help
Entry
HMPREF0351_11575  CDS       T02120                                 

Gene name
gpmA3
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
efu  Enterococcus faecium DO
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0351_11575 (gpmA3)
   01230 Biosynthesis of amino acids
    HMPREF0351_11575 (gpmA3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0351_11575 (gpmA3)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0351_11575 (gpmA3)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0351_11575 (gpmA3)
Enzymes [BR:efu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF0351_11575 (gpmA3)
Exosome [BR:efu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF0351_11575 (gpmA3)
  Exosomal proteins of melanoma cells
   HMPREF0351_11575 (gpmA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1546715..1547383)
Genome map
AA seq 222 aa AA seqDB search
MKLVLLRHGESEANFENYWTGWLDVALTEKGKEQAAVAGQKMLEAGLQFDAVYTSVLKRA
ILTGQVALEEMGQLWLPIIKTWRLNERHYGDLVGKNKDKMKEIYGKDQVKTWRRGYTEVP
PLTAENRFDRRYDHLDPHLIPYGESLEMTVNRIIPLWQDHLAPKLKDRQDLLVVGHGNSI
RALTKYLEDVPEDQMDTIDIPNAQPIQYTLADDLTILDKKIL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtattattacgtcatggcgaaagcgaagcaaattttgaaaattactggaca
ggatggctagatgtcgccttaacagaaaaaggaaaagaacaagcagcagttgccggtcaa
aaaatgcttgaagccggacttcaattcgatgccgtttatacctctgttttgaaacgtgcg
attcttaccggacaagtcgcactagaagaaatgggtcagttatggcttcctataataaaa
acatggcgtctaaatgaacggcattatggggatcttgtgggtaaaaacaaagataagatg
aaagaaatatacggaaaagatcaagtaaaaacatggcgcagaggatatacggaagttccg
ccgttaaccgcagaaaatagatttgaccgcagatatgatcacttggatccgcatttgatc
ccatacggagaaagtctggaaatgacagtgaatcggatcattcccttatggcaagatcat
ctagcaccaaaactaaaagatcggcaagatttactagttgtgggtcatggtaatagcatc
cgagcactgacaaaatatttagaagatgttcctgaagatcaaatggatacgatcgatatc
ccaaatgcacaaccaatccagtatacattagcagatgatttgacaattctggacaaaaaa
atactttaa

DBGET integrated database retrieval system