KEGG   Enterococcus faecium DO: HMPREF0351_11707Help
Entry
HMPREF0351_11707  CDS       T02120                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
efu  Enterococcus faecium DO
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0351_11707 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0351_11707 (glcK)
   00052 Galactose metabolism
    HMPREF0351_11707 (glcK)
   00500 Starch and sucrose metabolism
    HMPREF0351_11707 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0351_11707 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF0351_11707 (glcK)
   00524 Butirosin and neomycin biosynthesis
    HMPREF0351_11707 (glcK)
Enzymes [BR:efu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HMPREF0351_11707 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1685773..1686735)
Genome map
AA seq 320 aa AA seqDB search
MDKKIIGIDLGGTTAKFAILTPEGEIQQKWSIDTNILDDGKHIVPEIIESINHRLNLYNM
KAEDFIGIGMGTPGSVDSEAGTVIGAYNLNWTEVQFVKKLIEAGTGIKFAIDNDANVAAL
GERWKGAGENDPDVVFVTLGTGVGGGIVAGGNLIHGVSGAGGEIGHITVDPEGFECTCGK
RGCLETVSSATGVVRLGRFLAEEYAGDSKLKAMLDNGEEVTSKDIFEMAQEDDPFALMVV
DRVCFYLGLACGNLGNTLNPSSIVLGGGVSAAGEFLRSRVEKYFKEFTFPQVRESTKIKL
AELGNEAGVIGAASLALKFA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaagattattgggattgatttaggtggaacaacagcaaaatttgcaatttta
acaccagaaggagagattcagcaaaaatggagcatcgataccaatattttggatgatggt
aagcatatcgttcctgaaatcattgaatcaatcaatcatcgtttgaatttatataatatg
aaagccgaagactttatcggaatcggcatgggtaccccaggaagcgtggacagcgaagct
ggaacggttattggtgcgtataacttaaactggacagaagttcaatttgtgaaaaaactg
atcgaggcaggaacaggaatcaaattcgctatcgataatgacgcgaatgttgctgcttta
ggtgaacgatggaaaggtgctggagaaaacgatccagacgttgtattcgttactctagga
acaggtgttggcggaggtatcgttgctggcggaaatttgattcacggcgtgagcggagct
ggaggagaaatcggacatatcactgtggatcctgaagggttcgaatgtacttgcggtaaa
cgcggatgtttagaaactgtatctagcgctacaggtgtggtacgcctaggtcgtttcttg
gcagaagaatacgcaggggattcaaaactgaaagcaatgctagacaacggagaagaagta
acaagtaaagatatctttgaaatggctcaagaagacgatccgtttgcattgatggttgtt
gatcgcgtatgcttctacttaggtttagcttgcggaaacttggggaatacattaaatccg
tcaagtatcgtgttaggtggaggagtatcggcagcaggagaatttttacgtagccgtgta
gagaaatattttaaagaatttactttcccgcaagtaagagaatcaacaaaaatcaaatta
gcagagcttggtaatgaagctggtgtcattggtgctgcctcattagccttgaaatttgct
taa

DBGET integrated database retrieval system