KEGG   Enterococcus faecium DO: HMPREF0351_11707Help
Entry
HMPREF0351_11707  CDS       T02120                                 

Gene name
glcK
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
efu  Enterococcus faecium DO
Pathway
efu00010  Glycolysis / Gluconeogenesis
efu00052  Galactose metabolism
efu00500  Starch and sucrose metabolism
efu00520  Amino sugar and nucleotide sugar metabolism
efu00521  Streptomycin biosynthesis
efu01100  Metabolic pathways
efu01110  Biosynthesis of secondary metabolites
efu01120  Microbial metabolism in diverse environments
efu01130  Biosynthesis of antibiotics
efu01200  Carbon metabolism
Module
efu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
efu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0351_11707 (glcK)
   00052 Galactose metabolism
    HMPREF0351_11707 (glcK)
   00500 Starch and sucrose metabolism
    HMPREF0351_11707 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0351_11707 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF0351_11707 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HMPREF0351_11707 (glcK)
Enzymes [BR:efu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HMPREF0351_11707 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG PALP
Motif
Other DBs
NCBI-GeneID: 13000399
NCBI-ProteinID: YP_006376313
UniProt: Q3XZ87
Position
complement(1685773..1686735)
Genome map
AA seq 320 aa AA seqDB search
MDKKIIGIDLGGTTAKFAILTPEGEIQQKWSIDTNILDDGKHIVPEIIESINHRLNLYNM
KAEDFIGIGMGTPGSVDSEAGTVIGAYNLNWTEVQFVKKLIEAGTGIKFAIDNDANVAAL
GERWKGAGENDPDVVFVTLGTGVGGGIVAGGNLIHGVSGAGGEIGHITVDPEGFECTCGK
RGCLETVSSATGVVRLGRFLAEEYAGDSKLKAMLDNGEEVTSKDIFEMAQEDDPFALMVV
DRVCFYLGLACGNLGNTLNPSSIVLGGGVSAAGEFLRSRVEKYFKEFTFPQVRESTKIKL
AELGNEAGVIGAASLALKFA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaagattattgggattgatttaggtggaacaacagcaaaatttgcaatttta
acaccagaaggagagattcagcaaaaatggagcatcgataccaatattttggatgatggt
aagcatatcgttcctgaaatcattgaatcaatcaatcatcgtttgaatttatataatatg
aaagccgaagactttatcggaatcggcatgggtaccccaggaagcgtggacagcgaagct
ggaacggttattggtgcgtataacttaaactggacagaagttcaatttgtgaaaaaactg
atcgaggcaggaacaggaatcaaattcgctatcgataatgacgcgaatgttgctgcttta
ggtgaacgatggaaaggtgctggagaaaacgatccagacgttgtattcgttactctagga
acaggtgttggcggaggtatcgttgctggcggaaatttgattcacggcgtgagcggagct
ggaggagaaatcggacatatcactgtggatcctgaagggttcgaatgtacttgcggtaaa
cgcggatgtttagaaactgtatctagcgctacaggtgtggtacgcctaggtcgtttcttg
gcagaagaatacgcaggggattcaaaactgaaagcaatgctagacaacggagaagaagta
acaagtaaagatatctttgaaatggctcaagaagacgatccgtttgcattgatggttgtt
gatcgcgtatgcttctacttaggtttagcttgcggaaacttggggaatacattaaatccg
tcaagtatcgtgttaggtggaggagtatcggcagcaggagaatttttacgtagccgtgta
gagaaatattttaaagaatttactttcccgcaagtaagagaatcaacaaaaatcaaatta
gcagagcttggtaatgaagctggtgtcattggtgctgcctcattagccttgaaatttgct
taa

DBGET integrated database retrieval system