KEGG   Enterococcus faecium DO: HMPREF0351_12056Help
Entry
HMPREF0351_12056  CDS       T02120                                 

Definition
(RefSeq) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
efu  Enterococcus faecium DO
Brite
Enzymes [BR:efu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     HMPREF0351_12056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Peptidase_S9 DLH BAAT_C Abhydrolase_1 PGAP1 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 13000754
NCBI-ProteinID: YP_006376662
UniProt: Q3XY80
Position
complement(2005101..2005847)
Genome map
AA seq 248 aa AA seqDB search
MRQLPKPLYAKHGKRAVLLLHAYSGSPNDVRMLARFLEKADYTVYAPLFKGHGTMEPYDI
LQEKAESWWADTKKAIHFLQSEQFSDIAVLGLSMGGIFAVRALEEESVIGGGFFCSPLSP
VKTNVPENFEKYVRQVLKTAGKSEKEINEKAVAYRSLAEQQLMDIQDQAAIVESRLSDIQ
QPIFLAQAGKDEMIDPNGVFETARKLSRQRVTLQWYPESGHVITVGTARRELEKDVLEFL
EKLPWNEE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaattaccaaaacccctttatgcaaaacatggaaagcgagcggttttgctgctt
cacgcttactcaggaagtccaaacgatgttcgaatgctcgcacgatttttggaaaaagca
gattatacagtttatgcgccgctttttaaaggacacggaacaatggagccatatgatatc
ttgcaagaaaaagcagaaagctggtgggcagacactaaaaaagccatccattttttacag
tctgagcagttttctgatattgccgtattaggattatcaatgggcggcatctttgctgta
cgagcactagaagaagaatcagtgattggcggcggttttttctgttcgcctttgtctcct
gtaaaaacaaacgtgcctgaaaactttgaaaaatacgtacgtcaagtgctgaagacagca
ggtaaatcagagaaagaaatcaatgaaaaagcagttgcttaccgctcgttagctgaacaa
caattaatggatatacaagatcaggcagcaatcgtagaaagtaggttgtcagatatccaa
cagccgatatttttagctcaagctgggaaagatgaaatgatcgaccctaatggcgtattt
gaaactgcacgcaagttgagccgtcagcgagtgacacttcaatggtatcctgaaagtggt
catgtgattacagttggtacagcaagacgcgaattagaaaaagacgtcttggaattttta
gaaaaattaccttggaatgaggaataa

DBGET integrated database retrieval system