KEGG   Enterococcus faecium DO: HMPREF0351_12098Help
Entry
HMPREF0351_12098  CDS       T02120                                 

Gene name
fbp
Definition
(RefSeq) fructose-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
efu  Enterococcus faecium DO
Pathway
efu00010  Glycolysis / Gluconeogenesis
efu00030  Pentose phosphate pathway
efu00051  Fructose and mannose metabolism
efu00680  Methane metabolism
efu01100  Metabolic pathways
efu01110  Biosynthesis of secondary metabolites
efu01120  Microbial metabolism in diverse environments
efu01130  Biosynthesis of antibiotics
efu01200  Carbon metabolism
Module
efu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0351_12098 (fbp)
   00030 Pentose phosphate pathway
    HMPREF0351_12098 (fbp)
   00051 Fructose and mannose metabolism
    HMPREF0351_12098 (fbp)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0351_12098 (fbp)
Enzymes [BR:efu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     HMPREF0351_12098 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos Metallophos_2 DUF1402
Motif
Other DBs
NCBI-GeneID: 13000797
NCBI-ProteinID: YP_006376704
UniProt: I3U3Y4
Position
complement(2041372..2043303)
Genome map
AA seq 643 aa AA seqDB search
MLSIPIFGGVLMDRYLDLLSEKFPTTEDVITEIINLEAILQLPKGTELFLSDIHGEFPAF
DHILRIGSGNLKEKIKDLFSEQMTETEISQFTIFTAYPEYVLTTDWYKKQDKSQLIHRLI
DLLRFTTVKYTRSKVRKGLPKEYSYIIEELLYIDDRINGKKDYVKKIIEQLVLMKEEEKF
LTKLAQTIQKSVIDHLHIVGDIFDRGTQAAKVMDRIMDFSSVDIQWGNHDILWIGAYCGS
EACLLTLLRIAARYNYLFELEKEYGLNLRPLFSFAHQTYQKNPVFTPKNRKDLSEREQEE
LEKIHQALSILQFKSEHQLLNRRPEFKMDDRKLLEKINYEESTIVLEGQLYELKGTCFQT
IQPDDPKKFLEEEQKVIDSLMYSFQHSLRMQKHMTFLIEKGGMYLTNNQHVLFHGCIPVD
EKGQLLAFELDQSYRGKELLGFFEKQITESAKDLTANEDLATDLIWYAWSGPFSPLFGKS
KMATFERYFLTEPHTHVEKSNPYYHLRDEEWFSEKILAEFDAKEEGSAIINGHTPVKVKK
GESPIKANGKAFVIDGGLSKAYQKTTGIAGYSLLCNSYGFQIVTHYPFLPIEQQFAKKSD
QTNVKKVIEQQLPRKLNRNTTKGMELQQQITQLQRLLDYRKDD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtataccaatttttggaggcgttttaatggaccgctatttagatttactttca
gagaagttccctacaacggaagatgtcatcacggaaatcatcaatctcgaagcaattttg
cagcttccaaaaggaacagagttatttttgagcgatatacatggcgaatttcctgctttt
gatcatattctgcgtatcggttcaggaaatcttaaagaaaagatcaaagaccttttctct
gaacaaatgacggaaacggagatcagccaattcactatttttacggcttatccagaatat
gtgttgacgactgattggtacaaaaaacaagataaatcccagctgatccatcgtttgatc
gatcttttacggtttacgacagtcaaatacactcgatcaaaagttcgaaaaggattgccg
aaagaatatagctatatcattgaggaactcttgtatatcgatgatcgtatcaacgggaaa
aaagactatgtaaaaaaaatcattgaacaacttgtcttgatgaaggaagaagaaaaattt
ttaacaaaacttgcgcagacgatccaaaaatctgtcatcgatcatttgcatatcgtgggt
gatatttttgatcgaggaactcaagcagccaaagtaatggatcgaatcatggatttttcc
tctgtagatatccagtgggggaatcatgatattttgtggattggtgcgtattgcggctct
gaggcatgtttattgacgcttttacggattgccgcacgctacaactatttatttgaatta
gagaaagaatatggattaaatttacgtccattattttcttttgcccatcaaacctatcag
aagaatccagtatttacccctaaaaacaggaaagatctatctgaaagagagcaagaagaa
ttagaaaagatccatcaagcactttctatcctccaattcaaatcagaacatcagttgttg
aatcgacgacctgaatttaaaatggacgatcgtaaattgttggaaaaaatcaactatgag
gaatcaacgatcgttttagaaggtcagctctatgagttgaaagggacttgttttcaaacg
atccagccagatgatcctaaaaaattcttggaagaggaacaaaaagtgatcgatagtttg
atgtattcattccagcactcgttaagaatgcaaaaacacatgacgtttttgatcgaaaaa
gggggaatgtatctcacgaacaatcagcatgtactgttccatggctgtatacctgtagat
gaaaaggggcagctcttagcatttgaattagaccaatcttatcgcggaaaagaactgctg
ggattttttgaaaaacagataactgaaagcgcaaaagatttgactgcaaatgaagatttg
gcgaccgatttgatttggtatgcgtggagcgggccattttcgcctttattcggcaagagt
aaaatggcaacttttgagcgctattttctcacagagcctcatacgcacgtcgaaaaaagc
aatccctattatcacttgcgagatgaagagtggttcagtgaaaaaattttggcagaattc
gatgcaaaagaagaaggttcagcaatcatcaatggacacacgccagtaaaagtaaaaaaa
ggagagtcaccgatcaaagcaaacggaaaagcatttgttattgacggaggtctatccaaa
gcttatcaaaaaacaaccgggattgctggctactcattactatgcaattcttacggtttc
caaatcgtgacacattatccgttcttgcctattgaacaacaatttgcaaaaaaatctgat
caaacgaatgtaaaaaaagtgatcgagcagcagctcccacgcaaacttaatcggaatacg
acaaaaggaatggaattacagcaacagattactcaactccaaaggctgttggattatcga
aaggacgattga

DBGET integrated database retrieval system