KEGG   Enterococcus faecium DO: HMPREF0351_12098Help
Entry
HMPREF0351_12098  CDS       T02120                                 

Gene name
fbp
Definition
fructose-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
efu  Enterococcus faecium DO
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:efu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:efu00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:efu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:efu00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:efu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2041372..2043303)
Genome map
AA seq 643 aa AA seqDB search
MLSIPIFGGVLMDRYLDLLSEKFPTTEDVITEIINLEAILQLPKGTELFLSDIHGEFPAF
DHILRIGSGNLKEKIKDLFSEQMTETEISQFTIFTAYPEYVLTTDWYKKQDKSQLIHRLI
DLLRFTTVKYTRSKVRKGLPKEYSYIIEELLYIDDRINGKKDYVKKIIEQLVLMKEEEKF
LTKLAQTIQKSVIDHLHIVGDIFDRGTQAAKVMDRIMDFSSVDIQWGNHDILWIGAYCGS
EACLLTLLRIAARYNYLFELEKEYGLNLRPLFSFAHQTYQKNPVFTPKNRKDLSEREQEE
LEKIHQALSILQFKSEHQLLNRRPEFKMDDRKLLEKINYEESTIVLEGQLYELKGTCFQT
IQPDDPKKFLEEEQKVIDSLMYSFQHSLRMQKHMTFLIEKGGMYLTNNQHVLFHGCIPVD
EKGQLLAFELDQSYRGKELLGFFEKQITESAKDLTANEDLATDLIWYAWSGPFSPLFGKS
KMATFERYFLTEPHTHVEKSNPYYHLRDEEWFSEKILAEFDAKEEGSAIINGHTPVKVKK
GESPIKANGKAFVIDGGLSKAYQKTTGIAGYSLLCNSYGFQIVTHYPFLPIEQQFAKKSD
QTNVKKVIEQQLPRKLNRNTTKGMELQQQITQLQRLLDYRKDD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtataccaatttttggaggcgttttaatggaccgctatttagatttactttca
gagaagttccctacaacggaagatgtcatcacggaaatcatcaatctcgaagcaattttg
cagcttccaaaaggaacagagttatttttgagcgatatacatggcgaatttcctgctttt
gatcatattctgcgtatcggttcaggaaatcttaaagaaaagatcaaagaccttttctct
gaacaaatgacggaaacggagatcagccaattcactatttttacggcttatccagaatat
gtgttgacgactgattggtacaaaaaacaagataaatcccagctgatccatcgtttgatc
gatcttttacggtttacgacagtcaaatacactcgatcaaaagttcgaaaaggattgccg
aaagaatatagctatatcattgaggaactcttgtatatcgatgatcgtatcaacgggaaa
aaagactatgtaaaaaaaatcattgaacaacttgtcttgatgaaggaagaagaaaaattt
ttaacaaaacttgcgcagacgatccaaaaatctgtcatcgatcatttgcatatcgtgggt
gatatttttgatcgaggaactcaagcagccaaagtaatggatcgaatcatggatttttcc
tctgtagatatccagtgggggaatcatgatattttgtggattggtgcgtattgcggctct
gaggcatgtttattgacgcttttacggattgccgcacgctacaactatttatttgaatta
gagaaagaatatggattaaatttacgtccattattttcttttgcccatcaaacctatcag
aagaatccagtatttacccctaaaaacaggaaagatctatctgaaagagagcaagaagaa
ttagaaaagatccatcaagcactttctatcctccaattcaaatcagaacatcagttgttg
aatcgacgacctgaatttaaaatggacgatcgtaaattgttggaaaaaatcaactatgag
gaatcaacgatcgttttagaaggtcagctctatgagttgaaagggacttgttttcaaacg
atccagccagatgatcctaaaaaattcttggaagaggaacaaaaagtgatcgatagtttg
atgtattcattccagcactcgttaagaatgcaaaaacacatgacgtttttgatcgaaaaa
gggggaatgtatctcacgaacaatcagcatgtactgttccatggctgtatacctgtagat
gaaaaggggcagctcttagcatttgaattagaccaatcttatcgcggaaaagaactgctg
ggattttttgaaaaacagataactgaaagcgcaaaagatttgactgcaaatgaagatttg
gcgaccgatttgatttggtatgcgtggagcgggccattttcgcctttattcggcaagagt
aaaatggcaacttttgagcgctattttctcacagagcctcatacgcacgtcgaaaaaagc
aatccctattatcacttgcgagatgaagagtggttcagtgaaaaaattttggcagaattc
gatgcaaaagaagaaggttcagcaatcatcaatggacacacgccagtaaaagtaaaaaaa
ggagagtcaccgatcaaagcaaacggaaaagcatttgttattgacggaggtctatccaaa
gcttatcaaaaaacaaccgggattgctggctactcattactatgcaattcttacggtttc
caaatcgtgacacattatccgttcttgcctattgaacaacaatttgcaaaaaaatctgat
caaacgaatgtaaaaaaagtgatcgagcagcagctcccacgcaaacttaatcggaatacg
acaaaaggaatggaattacagcaacagattactcaactccaaaggctgttggattatcga
aaggacgattga

DBGET integrated database retrieval system