KEGG   Enterococcus faecium DO: HMPREF0351_12275Help
Entry
HMPREF0351_12275  CDS       T02120                                 

Gene name
bglB2
Definition
beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efu  Enterococcus faecium DO
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0351_12275 (bglB2)
Enzymes [BR:efu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     HMPREF0351_12275 (bglB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2222997..2224433)
Genome map
AA seq 478 aa AA seqDB search
MEHKELTSFPKDFLWGSASAAYQVEGAWQEDGKGESVWDRFVRIPGKTFKGTNGDLAVDH
YHRYKEDIALMKEQGLKAYRFSVAWTRIFPNGRGEVNQAGLAFYERLIDELIENDIEPML
TLYHWDLPQALQDEYNGWESRQIIEDFTHYAETLFEAFRGKVHYWISLNEQNIFTSLGYL
LAAHPPGVTDPKRMYEVNHIANLANASVINKFHELEMPGKIGPSFAYTPNYPIDSNPENV
LAAENAEDLMANYWMDVYMWGKYPIAAMRFLEEKGWAPTIEAGDAELLESAKPDFLGINY
YQTATNAFNPLNGVGAGKMNTTGKKGSSEETGVPGMYKKVENPFVERTNWDWEIDPEGLR
IGLRRITSRYRMPVLITENGLGEYDKLTEDKQIHDDYRINYLQSHVKAIKEAISDGAEVL
GYCTWSYTDLLSWLNGYQKRYGFVYVDQDETQEGSLERYKKDSYYWYQKLIEENGENL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaaagaacttacctcatttccaaaagattttctgtggggctctgcttctgca
gcgtatcaagtagaaggagcttggcaagaagatgggaaaggagaatcagtctgggatcga
tttgtacggatacctggaaagacatttaaaggaacgaacggtgatttggcagtagaccac
tatcatcgttataaagaagatattgctttaatgaaagaacaaggtctgaaagcttaccgc
ttctctgtagcttggacacggatttttcctaatggacgaggagaagtcaatcaagctggg
ctcgctttttatgagagattgatcgacgaattgattgaaaacgatattgaacctatgttg
actttatatcattgggatcttccacaagcattgcaagatgaatataatggttgggaatca
cgtcagatcattgaagatttcactcattatgcagaaacattatttgaggcattccgcggg
aaagtccattactggattagtttgaatgaacaaaatatcttcacttcattaggttatttg
ttagcagcacatccgccaggtgtgacagacccgaaacgaatgtatgaagttaaccatatt
gctaatttagcaaatgcatctgtcatcaataaatttcacgagttagaaatgcctggaaaa
atcggaccaagctttgcgtatacgccaaattatccaattgacagtaatcctgaaaatgtt
ctggctgctgaaaatgcagaagacctgatggccaattattggatggatgtctatatgtgg
ggaaaatatccgattgctgccatgaggttcttagaagaaaaaggatgggcaccaacgatt
gaagctggcgatgcagaattgctagaatctgctaaaccagattttcttgggatcaattac
tatcaaacggcgacgaatgcattcaatccattaaacggagttggtgctggaaaaatgaat
acgacaggaaaaaaaggttcatcagaagaaactggagttcctggaatgtataaaaaagtt
gagaatccatttgtcgaacgaacaaattgggactgggagattgacccagaaggattaagg
atcggactgcgtcgtatcacaagccgttaccgcatgccggtactgattacggaaaatggc
ttaggagagtatgacaagttgacagaagataaacaaatccatgacgactatcgaatcaat
tacttacaaagccacgtcaaagccatcaaagaagcaatttcggatggagcagaagtccta
ggctattgcacctggtcttatacagatttgcttagctggctgaacggttatcaaaagcga
tatggatttgtatatgttgatcaagacgaaacacaagaaggatctttggaacgatataag
aaagacagttattactggtaccaaaaactgattgaagaaaatggagagaacctttag

DBGET integrated database retrieval system