KEGG   Enterococcus faecium DO: HMPREF0351_12478Help
Entry
HMPREF0351_12478  CDS       T02120                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
efu  Enterococcus faecium DO
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF0351_12478
   00500 Starch and sucrose metabolism
    HMPREF0351_12478
Enzymes [BR:efu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     HMPREF0351_12478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2428009..2428932)
Genome map
AA seq 307 aa AA seqDB search
MRMKDKLIIGKNAIDTPTDFETIQEGIDYLAGLPDSHPKVLIVKEGRYDEYIESRLSNFK
LVGAGTVVISGNRFAKQEYLDGSQLGTFRSATFFLEGSNVVLENLHIENTAGPGEKVGQA
VALFNSGDRVSLKNCRLSGYQDTLCTGPLPDLQKDGTPFCTPASANPEYCRQTYEYCWIE
GTVDFIFGGADAVFHQCHIHSLASKNPGYITAASTPKNQKTGYRFESCTLTAEPDTRNVY
LGRPWRPYANVLFEACKIGGHVHPTGWDNWDDKKNEQTVKFSERNNNYETSIKRPEWIHL
EKQGVQK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgaaagacaaactgataattggaaagaatgctatagataccccgacggatttt
gaaactatccaagaaggaatcgattatttggcaggcctgccggatagccatccaaaggtc
ttgatagtaaaagaaggaagatatgatgaatatatagaaagcagattatccaattttaaa
cttgtgggagcaggaacagtagttatctccggtaatcgttttgcaaaacaggagtatctt
gacggtagccagttagggactttccgaagtgctacttttttcttagaaggatcgaatgtc
gtattagaaaatcttcacatcgaaaatacagcaggtccaggagaaaaggtaggacaggct
gttgctttattcaattcaggagatcgcgtatctttaaaaaactgtcgactatctggttat
caggataccttatgcacgggtccgttgcctgatttgcaaaaagatggtactcctttttgt
acaccggcttctgccaatcctgagtattgtcgtcagacctatgaatattgctggattgaa
ggaacggtggatttcatatttggtggggcagatgccgtttttcatcagtgtcatatccat
agcttagccagtaaaaatcctggatacatcacagcagcatctacgccgaaaaatcaaaaa
acagggtatcgttttgaaagctgtaccttgactgcagaacctgatactagaaacgtctat
ttaggaagaccgtggcgtccgtatgcaaatgtcttatttgaagcgtgtaagataggtggg
catgttcacccaactggttgggataattgggatgacaagaaaaatgaacagactgtcaaa
ttctctgaacgtaataacaattatgaaacatcgatcaaaagacctgaatggatacattta
gaaaagcagggggttcagaaatga

DBGET integrated database retrieval system