KEGG   Enterococcus faecium DO: HMPREF0351_12663Help
Entry
HMPREF0351_12663  CDS       T02120                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
efu  Enterococcus faecium DO
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:efu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2639742..2641427)
Genome map
AA seq 561 aa AA seqDB search
MYTKLLQAIYRDSDLSEKTASMIEQKVSVYQQKKGQAGKLHWDEEDIFLITYGDQFFEEQ
QPTLRTFKKFYQKYLADTFRVVHFLPFFPYTSDDGFSVVNYQAINDRLGTWEDIEEMRSE
TRLMFDFVCNHMSAESTWFQEYLNLNDTYKDFFIDLPLDTDTSSVTRPRTSPLLTTFIDK
NGKEKHVWTTFSEDQVDLNFKNPEVLLKMIDILLFYLEKGASFIRLDAVGFLWKELGTSC
IHLPETHKIIQLFRAIADEAAPGTVLITETNVPHKDNISYFGNGENEAQMVYQFSLPPLT
LQAIRSGNTSKLKEWLKTIDFASKKTTFFNFLASHDGIGLNPVRGILPEKTILELVEQLK
KEGARVNYKKNPDGTTSPYEINATYLDALSSPTDTTEWRSKRFLAAHSFLVTLPGVPAIY
IQSVLGSRNDYKGVEKTGENRKINRQKFLLADIEKELQTDPLRTAVYGELTQMLSIRKKE
KAFHPNSLIYLLDSADSFISFIREAKEEKVLVIHNFSNQSAGYLLPKGDYLDLFSGQIIH
CSQERKLIFQPYEYMWLKIIK
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaaaacttttacaagcgatttatcgcgactcagatttgtctgagaaaaccgcc
tctatgattgaacaaaaagtcagtgtttatcagcagaagaaaggccaggcaggcaaactg
cattgggacgaagaagatattttcttgattacttatggggatcaattttttgaagagcag
caaccaactttgcgtacatttaagaaattttatcaaaagtatttggcagatacatttaga
gttgtacatttcttgccatttttcccatatacatctgatgatggtttctccgttgtaaat
tatcaggcaatcaacgaccgtttgggcacatgggaagatatagaagaaatgagaagcgaa
acacggttaatgttcgactttgtctgcaatcatatgtctgccgaaagtacttggtttcag
gaatatttaaacttgaatgatacgtacaaagatttttttattgatttgccactggataca
gatacaagcagcgtgactagaccaaggaccagcccgttacttacaacgttcattgacaaa
aacgggaaagaaaaacacgtatggacgacttttagcgaagatcaagtagacttgaatttt
aaaaatccagaagttttattgaaaatgatcgatattcttttgttttacttagaaaaaggc
gcttcatttattcgcttggacgctgtgggatttttatggaaagaactaggaacttcttgt
atacacctgccagaaacgcataaaatcatccaattattccgtgcaatcgctgatgaagca
gctccaggaacggtattgatcactgagacaaatgtgccacacaaagataatatcagttat
tttgggaatggcgagaatgaagcacagatggtctatcagttttcgctaccacctttgacc
cttcaagcgattcgttcgggtaatacaagtaagttgaaagaatggttaaaaaccatcgat
ttcgcatcgaaaaaaacaactttttttaattttttagcctcccatgacggtatcggattg
aatccggtacgaggtattctgccggaaaaaacgatccttgaattagtggaacagctgaag
aaagagggtgcccgagtaaactacaagaaaaacccagatggaacgaccagtccatatgag
ataaacgctacgtatctagatgcgttaagttctccaacagatacgacggaatggagaagc
aaacgctttttagctgctcattcatttttggtaacgttaccaggcgtgccggcaatttat
attcaaagtgtgctgggaagtcgaaatgattacaaaggcgtagaaaaaacaggagagaat
cgaaaaatcaatcggcaaaaatttttgttagcagatattgagaaagagttgcagacagat
ccattaagaacagcagtatatggtgaattgacccagatgctatctattcgaaaaaaagaa
aaagccttccatccgaatagtttgatttacttactggactcagcagattcttttatcagt
tttattcgcgaagcgaaggaagagaaagtcttagttatccataatttttccaatcaatca
gcaggttatcttttaccaaaaggagattacctagacctgttttctggacaaattatccat
tgcagtcaagaacgaaagttgatattccagccgtatgaatatatgtggctgaaaataata
aaataa

DBGET integrated database retrieval system