KEGG   Enterococcus faecium DO: HMPREF0351_12783Help
Entry
HMPREF0351_12783  CDS       T02120                                 

Gene name
bgaB
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
efu  Enterococcus faecium DO
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:efu00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p2:complement(27138..29150)
Genome map
AA seq 670 aa AA seqDB search
MKKQTQMYYGADYNPEQWSKDVILEDMTLMKQAGVNYVSINIFSWVSLQPNESTFDFSFL
DWLIDLLYQNEIMIDLANGTASPPAWLVNKYPDMMPMTIHGNRLVHGSRQHYCPTSETYR
HYAAVLSAEVAKRYHDHPGIVMWHINNEYTCHIHECYCARCRTRFQQWLEDKYQTIDALN
TAWSTKFWSQSYREWHEIFLPEQMPTSKNPAQQLDYARFISAMNLEIYLIEKEAIATYSK
NIPFMTNLMGLHKYVDGFKWAPEMDVVSWNTYPNPFSPMPYPQFLANDLTRSLKKKPFLI
MEQAPSAVNWREVNGRKKAGQMRLWSYEAIAHGSDGIMFFQWRQSRGGAEKFHSAVVPHG
QPAESRVFKECCQLGNELKELQEVVGTQFMADVAVVFDWENWWALELDAKPRSLKYIHQM
SRLYEALRDLNVTVDFVHPDEDISAYRFVIAPNLYSAHRSFGKKINNYVANGGVFLTNFF
SGIVNENDQVYLGGYPGLFKETLGITVEEFSPLKETMHGKITFDQHTFTSNLWEEVIHLD
QATSFGYFANDDLKDSPAITVNHYGDGYAYYIGTELAPSDLSLVLAKIFHDNHLEKTALR
FIAADTPVSVTCRKGKDYTLLFLINHTDNNEKIVLKNQGYSLLDGQRVNTIDVPAKDVQI
IKLMANADSK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaacaaacccagatgtattatggtgcagattacaatcctgagcaatggtcaaaa
gatgttattttagaagatatgacactgatgaaacaagctggcgtcaattacgtgagtatc
aatatttttagttgggtatccctccaaccaaatgaatcaacctttgatttttcgtttctt
gattggttgatcgatttattatatcagaacgaaataatgattgatctggctaacggtacc
gcttctcctcctgcatggttggtaaacaaatacccagatatgatgccgatgactattcat
ggcaatcgtttggtacacggctcaagacagcattactgcccgacttcagagacttatcga
cactatgcggcagtattgtctgcagaagtggccaaaagataccatgaccatcctggaatc
gtcatgtggcatatcaacaacgaatatacttgtcatatccatgagtgctattgcgctcga
tgccgcactagattccaacaatggttagaagataaataccaaacgatcgatgcattgaat
actgcatggtcaacgaaattttggagtcaaagctatagggagtggcatgaaatcttcttg
cctgaacaaatgccaacctccaaaaatcccgcacaacaattggattatgcacgctttatt
tcagcgatgaaccttgaaatctacttgattgaaaaagaagcaatcgctacctactcaaaa
aatataccatttatgacgaaccttatggggttacataaatatgtagacggtttcaaatgg
gctcctgaaatggatgttgtgagttggaacacatacccaaatccttttagtccgatgccc
taccctcaatttctagccaatgacctaacccgcagccttaagaaaaagccgtttttgatc
atggaacaagccccaagtgccgtaaactggcgggaagtcaacgggagaaaaaaagctggt
caaatgcgcttgtggagttatgaagcgattgctcatggctctgatgggatcatgttcttt
caatggcggcaatcaaggggcggcgctgagaaattccatagcgcagttgtcccacatggt
caacctgctgagagtcgtgtcttcaaagaatgctgtcagttaggcaatgaattaaaagaa
ttgcaggaagtggttggtacacaattcatggcggacgtagctgtagttttcgattgggaa
aactggtgggcgctggaacttgatgcaaaaccacgttcattaaaatatattcatcaaatg
agccgtttatacgaagctttgagggatttgaatgtaactgtcgactttgtccacccggat
gaagatatcagcgcctatcgctttgtgattgcaccaaatctatattcagcccatcgatcg
tttggtaagaaaatcaataattacgtggccaatggcggtgttttcttgaccaatttcttc
agcggtatcgtcaatgaaaatgatcaagtatatttaggcggttaccctggcctctttaaa
gagacactaggcattactgtcgaagaattctcccctttaaaagaaactatgcacggaaaa
atcacctttgaccagcacacattcacaagtaatttatgggaagaagtcattcatttagat
caagcaacgtcatttggatatttcgccaatgatgacttgaaagactcccctgcgatcaca
gtgaatcattatggtgacgggtatgcttattatattggcactgaattagcaccatcagat
ttgtcactcgtattagcaaaaattttccatgacaatcatctagaaaaaacagcattaaga
tttatagcagcagatacgccagtgtctgtgacttgccgcaaaggtaaggactacaccttg
ctcttcttgatcaaccatacagataacaacgaaaaaatcgtactaaaaaatcaagggtat
tctcttctcgatggccaaagggtcaatactatcgatgtccctgctaaagacgtgcagata
attaaacttatggctaatgccgatagcaaatga

DBGET integrated database retrieval system