KEGG   Enterococcus faecium DO: HMPREF0351_12969Help
Entry
HMPREF0351_12969  CDS       T02120                                 

Gene name
lacZ2
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
efu  Enterococcus faecium DO
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HMPREF0351_12969 (lacZ2)
Enzymes [BR:efu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     HMPREF0351_12969 (lacZ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p3:complement(127834..129612)
Genome map
AA seq 592 aa AA seqDB search
MTTFEIKEEFLLKGKTFKILSGAIHYFRIPPCDWEHSLYNLKALGFNTVETYVPWNLHEP
QKGEFHFEGILDLERFLTIAQDLGLYAIVRPSPYICAEWEFGGFPSWLLREPIHIRRNEI
AYLEHVADYYDVLMKRIVPHQLNNGGNILMIQIENEYGSFGEEKEYLRAIRDLMIKRGVT
VPFFTSDGPWRATLRAGSMIEDDILVTGNFGSKAKDNFNSMKQFFKEYDKNWPLMCMEFW
DGWFNRWKEPIIQRDPQELAEAVKEVLEQGSINLYMFHGGTNFGFMNGCSARGVIDLPQI
TSYDYGAPLDEQGNPTEKYYALRKMIHDNYPEIKQLDPVIKPTIEKKKISLTNKVSLFAT
LDTISQPVQSKYPKTMEELGQNTGYLLYRTMIERDAEEERLRVIDGRDRSQLFLNQELQA
TQYQTEIGEDIQVSMTEEINQVDILIENMGRVNYGHKLFAETQKKGIRTGVMADLHFITN
WQQYSLPLENCKTVDYSKGWQPQHPSFYRYEFLLEDIGDCFIDLRKFGKGIVFVNQTNIG
RFWEVGPTLSLYISSGFLKVGKNEIVIFETEGTYEPEINLLKAPLYKEMKEG
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgactacatttgaaataaaggaagaatttttattaaagggaaaaacatttaaaatacta
tctggtgcaattcattattttcggattcccccatgtgattgggaacattctttgtacaat
ttaaaagcactaggatttaatacagtagagacatatgttccttggaatttacatgagcct
caaaaaggagagtttcattttgaagggatattggatttagagagatttttgacaatcgct
caagacttaggattatatgctattgtgcggccatcgccttatatttgtgctgaatgggaa
tttggagggtttccgtcatggctactccgtgaaccgattcatatccgaaggaatgaaatc
gcttatttggagcatgtagcggattattatgatgttttgatgaaaaggattgttccccat
caacttaataatgggggaaatatattgatgattcaaattgaaaatgagtatggatctttt
ggggaagaaaaggaatatttgcgtgcgataagagatttgatgattaagcgaggagtgaca
gttccttttttcacttcagatggaccgtggagggctactttacgagcgggaagcatgatt
gaagatgatattttggttactggtaattttggttctaaagcaaaagacaacttcaactct
atgaagcagttttttaaagaatatgataaaaattggccactgatgtgtatggaattttgg
gatggttggtttaatcgttggaaagaaccaattattcaacgagatccacaggaactcgct
gaagcggtaaaagaggtattagaacaaggaagcattaatttatatatgtttcatggagga
acgaattttgggtttatgaatggttgttcagcaagaggagtgattgatttaccgcaaatt
acttcctatgattatggtgcaccattagatgagcaggggaatccaacagaaaaatattat
gcattgcggaaaatgattcatgataattatccagagattaagcagctagatcctgtcatt
aaacccacgattgaaaagaaaaagatttctttgacgaataaggtaagtcttttcgcgact
ttagataccattagtcaaccggttcaatcaaagtatccaaagacaatggaagagttggga
caaaatacaggttatctactttaccgaacaatgatagagagggatgcagaggaagaacga
ttacgggtaattgatggcagagatcgcagccaattatttttgaatcaagaattacaagct
acccaatatcaaacagaaataggtgaagatatacaagttagtatgacagaagaaatcaat
caagtggatattttgattgaaaatatgggacgtgtcaattatggacataaactctttgcg
gaaacgcaaaaaaaaggaattagaacgggagtaatggcagacttacattttattacaaat
tggcaacagtattcattgcctttggaaaattgtaaaactgtggattattcaaaaggatgg
cagccccaacacccaagtttttatcgatatgagtttcttttagaggatatcggtgattgt
tttattgatttaaggaaatttggtaaaggaattgtctttgttaatcagaccaatataggt
cgtttttgggaagtaggtccaacgctttcactgtacatctctagcggctttctaaaagtt
ggtaagaatgaaattgttatttttgagacagaaggtacctatgaaccagaaatcaattta
ttaaaagcaccattatataaagaaatgaaagagggatga

DBGET integrated database retrieval system