KEGG   Ethanoligenens harbinense: Ethha_0710Help
Entry
Ethha_0710        CDS       T01384                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
eha  Ethanoligenens harbinense
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ethha_0710
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ethha_0710
Enzymes [BR:eha01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Ethha_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
764798..766087
Genome map
AA seq 429 aa AA seqDB search
MNKYVITGGKKLQGEVSISGAKNAAVAILPATVLAGGVCRIENVPNISDVSSLLDILTHM
GARVRFLQRSVVEIDTTHLHTPQVPYELARKMRASCYFLGALLGRYHRAQVAMPGGCDFG
VRPIDQHIKGMELLGATVLLEHGVVEVSASALCGTSIYLDVVSVGATVNVLLSAVCSEGL
TVIENAAKEPHIVDLANFLNAMGADVRGAGTDVIKVHGVPRLHGCTYSIIPDQIEAGTFM
AAAAATGGRVLLKNVIPKHLESISAKLAEMGVQITEYDDSLLVERNGALNHANLKTMPHP
GFPTDMQPQMAVLLSLAQGTSIITEGVWDNRFRYVEELKRMGANIQVDGKIAVVEGVGRL
LAAPVKATDLRAGAAMLIAGLVAHGVTEIEDIRHIERGYEYVDEKFRALGAQIERVSVTP
DGEPLASAV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
ttgaataagtatgtcatcacaggcgggaaaaaacttcagggcgaagtgagcatcagcggc
gcgaaaaatgctgctgtggcgatattgccggcaaccgtgctggccggcggcgtatgccgc
atcgagaacgttcccaatatcagcgacgtaagtagcctgttggatattctgacgcacatg
ggcgcgcgggtgcgttttctgcagcgctcggtggtggaaatcgatacgacccatctgcac
acgccgcaggtgccgtatgaactcgcacggaaaatgcgtgcgtcctgctattttctgggc
gcactgctggggcgctatcacagggcgcaggtggcgatgccgggcggctgtgatttcggt
gtgcgcccgatcgatcagcacattaaagggatggaactgcttggcgcgaccgtcctgctc
gagcacggtgtggtggaggtttcggcatccgccctgtgcggcacctcgatttatctggat
gtggtgtccgtgggcgcgacggtgaacgttctgctttccgccgtctgcagcgaaggtctg
acggtgatcgaaaacgcggcgaaagagccgcatatcgttgatctggcaaacttcctgaat
gccatgggcgcagatgtgcgcggagcgggcaccgacgtcatcaaggtgcatggcgtgccc
cgtctgcatggctgcacctattccatcatcccggaccagatcgaggcgggaacgtttatg
gcggcggctgcggcgaccggcgggcgcgtgctcctgaaaaacgttattcccaagcatctg
gagtcgatctccgcgaaactggcggaaatgggcgtgcagatcaccgagtacgacgactcg
ctcctggtcgaacgtaacggcgcgctcaaccatgccaacctgaaaaccatgccgcatccc
ggtttccccaccgatatgcagccgcagatggcggtgctgctttcgcttgcgcaaggtacc
agcatcatcaccgagggtgtgtgggacaatcgtttccgctatgtggaagaactcaagcgg
atgggcgcgaacattcaggtggacggcaagatcgcggtcgtagaaggcgtgggcaggttg
ctggcggcccctgtgaaggcgaccgatctgcgggccggcgcggccatgctgatcgccggg
ctggtggcgcatggcgtcacggagatcgaggatatccggcatattgagcgtggctatgag
tatgtggatgaaaaattccgggcactgggcgcgcagatcgagcgcgtgtccgtcacaccg
gatggtgaaccgctggccagtgcggtctga

DBGET integrated database retrieval system