KEGG   Ethanoligenens harbinense: Ethha_0755Help
Entry
Ethha_0755        CDS       T01384                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
eha  Ethanoligenens harbinense
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Ethha_0755
  Lipid metabolism
   00600 Sphingolipid metabolism
    Ethha_0755
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Ethha_0755
Enzymes [BR:eha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Ethha_0755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
822303..825305
Genome map
AA seq 1000 aa AA seqDB search
MNLPNYYENPEITSIGTMPDRAYYIPVPEGTADAGGRLADSGCVTPLDGTWLFRLFPNVL
EVPECFPQPSYDESDMEPITVPSVWQCGGYDAHQYTNTRYPIPYDPPYVPFQNPCGAYAT
WFDYADQRDGSHMFLNFEGIDSCAYVYINGQFAGFHKISHAHVEYDITRFLREGRNKLAV
LVLKWCDGTYLEDQDKLRMSGIFRSVYLLRRAQNHLRDFTVSQQFSEDLKTAWLHVSARF
LEGIGSIAYRFWDGNTLLAQGESADGIFSLQVDAPKLWNAEQPYLYNLELSSCGETIREP
VGLRKIEMRKGVALLNGKSFKIKGVNRHDSDPVTGYTQSAEQLLRDLTLMKNHNINAVRT
SHYPPCPELLYLCDRLGFYVIDEADIEAHGGIDLYGADEREIGRLAADSRFANAILRRVQ
HLVARDKNRPSVIMWSLGNESGYGDNFVKAAEWVHAADASRPVHYESSVHPYPGTNTDLS
VLDVYSRMYASTQFVDTYFSQPQQKPFIQCEFCHAMGNGPGDLEDYFKQIYRYDGFWGGC
VWEWCDHAVYAGETPDGKPRYLYGGDFGDFPNDGNFCVDGLVFPDRTPSTGLLEYKNVLR
PVRAEAADTRQGIFILKNCQDFSDTGNTVDIVYELTRNGKTVQSGSLPTLSIAPHTAETV
SIPYVLPEDGRCFLRLRYLKKGGADCVPTGTELGFDQFELPVSGGFQLPELVVTAPVSFE
EGERYISIFGRDFRYGFDRYEGTFTSLTSKGKELLTGPMSLNIWRAPTDNDRNIKHEWYA
AGYDRALPKVYETDVKRDRDCVVLHCRSSLAPLFIQPVLHIDAAYRVHASGRVDVSFEVR
KNPVMPVLPRFGVRLFLDRAFSHVRYFAYGPIESYADKHQASYRGLFESTVEEQHVPYIR
PQENGSHFGSEYLELAGGGTALAFTSNRPFSFQASPYTQEELTQKEHEFELEPAGGTILC
VDYKQNGIGSNSCGPELLPDYRFDENAFTFAFSFLPYALD
NT seq 3003 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgccaaactattacgaaaatcctgaaatcaccagcattgggaccatgccggat
cgggcctattacatcccggtcccggagggaacggcagacgcgggcggccggctggccgat
tccggctgcgtgaccccgttggatggaacatggcttttccggttgttccccaatgtgctg
gaagtgccggaatgcttcccgcagccatcctatgatgagtctgacatggaaccgatcacg
gtgccgtctgtctggcaatgcggcgggtacgatgcgcaccagtataccaacacgcggtat
cccatcccgtatgacccgccgtatgtgcctttccaaaacccctgcggcgcctatgccact
tggtttgactacgccgaccagcgggatggctcgcatatgttcttgaattttgaagggatt
gattcctgtgcgtatgtctacataaacggacaatttgccggttttcataaaatctcgcat
gcgcatgtggaatacgacattacccgttttctgcgggaaggccgtaacaaactggctgtt
ttggtattgaaatggtgtgatggcacctatttggaggatcaggacaaattgcgtatgtcc
ggtattttccgaagtgtttatctcctgcggcgtgcgcagaaccatttgcgggattttacg
gtttcccaacagttttcagaagatctgaaaaccgcatggctgcacgtaagcgcccggttt
ttagagggtatcggatcgatcgcataccgattttgggacggcaatacgctcttggcgcag
ggagaatccgccgacggaatcttttctctgcaagtggacgcaccaaaactctggaatgcg
gaacagccttatctctataacctggagctgtcgtcctgcggagaaacgatccgggaaccg
gtggggctgcgcaaaatcgagatgcgaaaaggcgtggcgctcctgaacggcaaatcgttt
aaaatcaaaggcgtcaaccggcacgacagcgatccggtgaccggttatacacaatctgcg
gaacagcttctgcgtgacttgacattgatgaaaaaccacaacatcaatgccgttcgcacc
agccactaccctccttgccccgaactgctgtacctgtgcgaccggctgggattttatgtg
atcgacgaggcggacatcgaagcgcacggcggcattgatctctatggcgcggatgaacgg
gagatcggcaggctggcggcggacagccgttttgcaaacgccatcctccgccgggtgcag
cacctggtcgcacgggacaaaaaccgccccagtgtcatcatgtggtcgcttgggaatgag
tccggatatggggacaattttgtaaaagccgccgaatgggttcacgcagccgatgcttcc
cgcccggtccattacgaaagcagcgtgcatccttatccgggcacgaacaccgatctgtcg
gtgttggatgtctacagccgcatgtatgcgtccacccagtttgtggatacctatttcagc
caaccgcagcaaaaaccgtttatccagtgtgagttctgccacgcgatgggcaacggcccg
ggggatctggaagattatttcaaacagatctatcgttatgacggcttttggggagggtgt
gtttgggaatggtgtgaccacgccgtctatgccggggaaacgccggatgggaagcccagg
tatctgtatggcggtgatttcggtgattttccaaacgacggaaatttttgtgtggatggt
ctggtctttccggaccgcacaccgtccacggggcttctggaatataaaaacgttctgcgg
ccggtgcgcgcagaggctgcggatacgcggcaaggtattttcattctgaaaaactgccag
gatttttccgacacgggcaatacggtggacattgtttacgaactcacgcgcaacggcaaa
acggtgcaatccggctcgttgccgactctgtccattgcgccccacacggcagagaccgtc
agcattccctacgtgctgccggaagacggacgctgctttttgcgcctgcgctatctgaaa
aagggcggcgccgattgtgtccccacggggacagagctgggtttcgaccagtttgaactc
ccggtcagtggcgggttccaactgccggagcttgtggtgaccgctccggtctcttttgag
gaaggggaacggtacatctctatcttcggccgggacttccgctatggctttgaccgttat
gaggggacgttcaccagtttgacttctaaaggcaaagaactgctcacagggcccatgagc
ctgaatatctggcgcgcgcctaccgataacgaccgaaacatcaaacacgaatggtatgcg
gccggatatgaccgggcgcttcccaaggtgtatgagacggatgtgaaacgagacagggac
tgtgtggtattgcattgtcggtcatcactggcgccccttttcatccagcccgtcctgcac
atcgacgctgcctaccgcgtacacgcgagcggtagggtggacgtttcttttgaggtccgc
aaaaaccccgttatgcccgttcttccacggttcggtgtccggctgtttttagatcgcgca
ttttcgcatgtgcgctattttgcctacgggccgatcgaaagctatgccgacaaacatcag
gcgtcttaccgcggcttgtttgaaagcacagtggaagagcagcatgtgccgtatatccgt
ccgcaggaaaacggctcccacttcggcagcgaatatctggagctggccgggggcggtacg
gctctggcattcacctcgaatcggccattcagttttcaggcatcgccgtacacccaggaa
gaactcacgcaaaaagagcatgaatttgaactggaaccggccgggggcacgattttgtgc
gtggactataaacagaacggcatcggctccaacagctgcggcccggaattgctgccagac
tatcgttttgatgaaaatgcgttcacttttgcattttcctttctgccctatgcattggat
tga

DBGET integrated database retrieval system