KEGG   Ethanoligenens harbinense: Ethha_0769Help
Entry
Ethha_0769        CDS       T01384                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
eha  Ethanoligenens harbinense
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eha00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ethha_0769
Enzymes [BR:eha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Ethha_0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(841018..843225)
Genome map
AA seq 735 aa AA seqDB search
MEEQETLRGTVESVVFRNRENGWTVFELACGEELCTVVGHVFEIAEGETLTVKGEWGKHP
SYGRQFKAETFERELPATESAMLRYLSSGAVKGVGPATAKRIVDVFGVDTLDILENHPER
LTEVRGISEKKAQEMSEAYKSQFGVRTCMLFLQQYNVTAAQAIRVWKRFGANAVDIIKRN
PYALCESGLYIGFERADAIAMQMGMDKGDAFRIHAGIAHILRHNLYSGGHTYIPREKLAG
LAQALLGIDADTAASTIDDMAAEGELEDEEIGGRQVLFLPESHRAESYIAGRLLLMRGIR
LPEMGDSGTRIREAEERMGITYARKQREAIETACRNSVMILTGGPGTGKTTTLNAIIHVY
EGMGLKVALAAPTGRAAKRMSEVSGREAKTIHRLLEMSFESEDTARFTRNEKNPLDCDTV
IVDELSMVDVMLLESLLRALKLNCRLVMVGDADQLPPVGPGNALRDMIDSGKVPTVVLDE
IFRQAAKSLIVTNAHRIVRGKMPELARRDGNFFFMPRYTAAQVSTTVVELMHTRLPAAYG
YSPLWDMQVLTPGRKGELGSGAFNKLLQDVLNPAGGGKAERPTVFGVLREGDKVMQVKNN
YDLAWQRDNGEQGAGVYNGDVGLLERIDRRTGTLWVRFDDRLAEYGPDHAEELELAYAVT
VHKSQGSEFKAVVLPLFSGAPMLFYRNLLYTAVTRAKEITILVGRKETIEQMVQNDRRSK
RYTGLCAFLQAGEEP
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacaggaaacgctgcgcggcaccgtggaatcggtggtattccgcaacagggaa
aacggctggacggtttttgaactggcctgcggcgaggaactctgcaccgtggtggggcat
gtgttcgagatcgccgaaggcgaaacgctcaccgtcaagggcgaatggggcaagcacccc
tcctacggccggcaattcaaggcggaaaccttcgagcgcgagctgcccgccaccgagtcc
gccatgctgcgttatctctcctccggcgcagtcaaaggggtcggccccgccaccgccaaa
cgcatcgtggacgtgttcggcgtggacacgctggacattcttgaaaaccaccccgaacgg
ctcacggaggtccggggcatctccgaaaaaaaggcgcaggagatgagcgaagcctacaaa
agccagttcggcgtgcgcacctgcatgctgtttctacagcaatacaacgtcacggcagcg
caggctatccgtgtctggaagcgcttcggcgccaatgccgtggacatcatcaagcgcaac
ccctacgccctctgtgaatccggactgtacatcgggtttgagcgcgcggacgccatcgcc
atgcagatgggcatggacaagggcgacgcctttcgcatccacgcgggcatcgcgcacatt
ctgcgccacaacctttacagcggcggccacacctacatcccgcgggaaaaactcgccggg
ctggcgcaggctctgctcggcatcgacgcagacacggccgcctccaccatcgacgatatg
gcggccgagggagaactggaagacgaggagatcggcgggcggcaagtgctgttcctgccg
gaatcacaccgcgccgaaagctacatcgccgggcggctgctgctcatgcgcggcatcagg
ctgccggaaatgggcgactccggcacccgcatccgcgaagcggaggaacgcatgggcatc
acctatgcccgcaagcagcgggaagccatcgagaccgcctgccgcaacagcgtgatgatt
ctcaccggcgggccgggcaccggcaaaaccaccaccctcaacgccatcatccatgtttac
gagggcatggggctgaaagtggcgctggccgcgcccaccggccgggcggccaagcggatg
tcggaggtttcggggcgggaagccaaaaccatccaccgcctgctggaaatgtcgtttgaa
agcgaggataccgcgcgtttcacccgcaacgagaaaaacccgcttgactgcgacaccgtc
atcgtggacgagctttcgatggtggatgtgatgctgcttgaatcgctgctgcgcgcgctg
aaactaaactgccgccttgtgatggtgggcgacgccgaccagttgccgccggtgggcccg
gggaacgccctgcgggatatgatcgactccggcaaggtgcccaccgtggtgctggacgag
attttccgtcaggccgccaaaagcctcatcgtcaccaacgcccaccgcatcgtccgcggc
aaaatgcccgaactcgcccgacgcgacggcaactttttcttcatgccgcgctacaccgcc
gcgcaggtaagcaccaccgtagtggaactgatgcacacccgcctgcccgccgcctacggc
tattccccgctgtgggatatgcaggtgctcacaccgggacgaaaaggtgaactgggctcc
ggcgcgttcaacaaactgcttcaggacgtgctcaaccccgcgggcggcggtaaggcagaa
cgcccgacggtgttcggggtgctacgcgagggcgacaaggtcatgcaggtgaaaaacaat
tacgatctcgcgtggcagcgcgacaacggcgagcagggcgcgggcgtctacaacggcgac
gtgggcctgcttgaacggatcgaccgccgcaccggcacgctgtgggtgcgctttgacgac
cgtctggcggaatacggccccgaccatgcggaggaactggaactggcctatgcggtaacg
gtgcacaaaagtcagggcagcgagttcaaggccgtggtattgccgctgttttcgggcgcg
cccatgctgttctaccgcaacctgctctatacggcggtcacccgcgccaaagaaatcacc
atcctcgtggggcgaaaagagaccatcgagcagatggtgcagaacgaccgccgctccaag
cgatacaccgggctttgcgcgtttttgcaggcgggtgaggaaccatga

DBGET integrated database retrieval system