KEGG   Ethanoligenens harbinense: Ethha_0840Help
Entry
Ethha_0840        CDS       T01384                                 

Definition
glycoside hydrolase family 1
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eha  Ethanoligenens harbinense
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ethha_0840
Enzymes [BR:eha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Ethha_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(919902..921278)
Genome map
AA seq 458 aa AA seqDB search
MGNAFKPDFLWGNSVSSMQTEGAVHEGGKGPSIYDDPELCVRGKSSDWVVAIDDYHRYDE
DIALMAGMHMNCYRFSISWSRVFPEGDGEVNPEGLAFYDSLIDRLLEHHIEPMICLYHFD
MPAHLAREYNGFSSRYVVNAFVKYGQTIIDRYKDKVKYWLTFNEQNLFGTDPSIGGSYLP
VNERNLYQTNHNALVAHARVVRYLHEHAKNAVIGGMIAYQLVYPASASPNDQLIAQEIDE
RLNQFYLNVYSHGKYPEYMLEYLKKHGCLPKFEATDVDDLLMGKVDFLAFSYYSSTTISA
NKIPVNMPVYRYKEFGLVDNPFTGTTEWNWQIDPVGFRLILDRMSIRYGLPVFPIENGIG
VDETAIDDEMILDDYRIAYHRQHLEQLQKAVTEDGVDCMGYLTWAAIDILSSAGQMKKRY
GFVYVNRDETDIKDLKRIPKKSYYWFAQVAQTNGQNLG
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgcttttaagccggattttttgtggggaaattccgtctcttctatgcaaacg
gaaggcgctgttcatgaagggggaaaaggtccttccatatacgatgatccggaattatgc
gttcgcgggaaatcttccgattgggtcgtggcaatcgacgactatcaccgttatgatgaa
gacattgcccttatggccggcatgcacatgaattgctaccgtttttccatttcctggtcc
cgtgtttttccggaaggagacggagaagtcaacccggagggtctggccttttatgacagc
ctgattgaccggcttcttgagcaccatattgaaccgatgatttgcctctatcattttgac
atgcctgcccacctggcaagggaatacaacggcttttcctcccgatatgttgtaaacgcc
tttgtcaaatatggccaaacgatcatcgaccgctataaggacaaagtgaaatattggctg
acattcaacgaacagaacttgttcggaacggacccgtccataggcggcagctatttgcct
gtcaatgagcggaatttgtaccagacaaaccataacgcactggttgcccacgcgagggtt
gtccgctatttgcatgaacatgcaaaaaatgcggtgatcggcggcatgatcgcttatcaa
ctggtctatccggcatccgcttcgccaaacgatcaactgatcgcccaggagatcgatgag
cgcctgaaccagttttatctgaatgtatacagtcatggaaaatatccggaatatatgtta
gaatatctgaaaaagcatggttgccttccaaagttcgaagcgacggatgtggacgacttg
ctaatggggaaagtggactttctcgctttcagttactatagcagcaccacgatcagtgca
aataaaatacccgtcaatatgccggtttaccgctataaagagtttggtcttgtcgataat
ccatttaccggtacgacagaatggaattggcagatcgatccggtcggtttccgcttgatt
ctcgacagaatgtccattcgctatggacttccggttttccccattgaaaacgggatcggc
gttgacgaaacagcaatagacgatgagatgatcctggatgattatcgtatcgcatatcac
cgccagcatcttgaacaattgcaaaaggccgttacggaagacggtgtggattgcatgggg
tatctgacctgggcggccattgacattttaagctctgccggtcaaatgaaaaagcggtat
ggattcgtttatgtgaatcgtgatgaaacagacataaaagatctaaagcgaatccccaaa
aagagctattattggtttgcgcaggttgcgcaaaccaacggacaaaatttaggctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system