KEGG   Ethanoligenens harbinense: Ethha_1029Help
Entry
Ethha_1029        CDS       T01384                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
eha  Ethanoligenens harbinense
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ethha_1029
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ethha_1029
Enzymes [BR:eha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Ethha_1029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1135553..1136956
Genome map
AA seq 467 aa AA seqDB search
MEKAQIEAYFAAHKQELLDDICRVVRIKSDKGESEPGKPFGAGPAAALAEVLRIAENMGF
RTQNYDNYVGTVDANDKEPQLNILAHLDVVPAGNGWTVTQPFEPVERDGRLYGRGTADDK
GPAIAALYALKAVKDLGVPLQKNVRLIVGTDEECGSSDIAYYYSKEKESPMTFSPDASFP
VINVEKARLEGELTARFTPSEMLPRVRRADAGVKANVVHDAACALVEGLTAEALAPYLQQ
AEERTGAHFAAAPAENGAEITAKGKAAHASTPEQGNNALTALLTLLAALPLAQSDGAAKL
RALARLFPHGDTTGSAAGVAMRDDVSGPLTISLNMLHVDETGISGVFDCRAPVCATEDNL
QNVLARRLEEAGFALEPHFSPAHHVPGDTPFVRTLLKCYEQYTGRKGECLYTGGGTYVHS
LKNGVAFGCSLPETDNRMHGADEFAVVDELLLAGQIFTQAIIDLCGA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagcgcagatcgaagcgtacttcgcggcccacaaacaggagctgcttgacgat
atctgccgcgtggtgcggatcaagagcgacaaaggcgagtccgaacccggcaaaccgttt
ggcgcggggccggcggcggcgctggcggaagtgctccgtatagcggagaacatgggcttt
cgcacccaaaactacgacaactatgttggcacggtggatgcaaacgacaaggagccccag
ctcaacatcctcgcgcacctcgacgtggtgcctgccgggaacggctggacggtgacgcag
ccgttcgagccggtggagcgggacggtcggctctacgggcgcggcacggcggacgacaaa
ggcccggccatcgcggcgctctatgcgctcaaggcggtcaaggatctcggcgtgcctttg
caaaaaaacgtgcggctcatcgtcggcaccgatgaagagtgcggcagctcggacatcgcg
tattattatagtaaggaaaaagaaagccccatgaccttttcgccggatgcgtcctttccg
gtcatcaatgtggaaaaggcgcggctggaaggggaactgaccgcgcggttcacaccgtcg
gaaatgctgccgcgcgtaaggcgggcggatgcgggcgtcaaagcaaacgtggtgcatgac
gccgcctgtgcgctggtggagggtcttacggcggaggcgctggcaccctacctgcagcag
gcggaggaacgcaccggtgcgcattttgccgccgccccggccgaaaacggcgcggagatc
acggcaaaaggcaaggccgcgcatgcctccacgccggagcagggcaacaatgccctcacc
gcgctgctcaccctgctggccgctctgccgctggcacagagcgacggcgcggccaaattg
cgcgcgctggcacggcttttcccgcacggtgacacgacgggcagcgcggcgggcgtggcc
atgcgggacgatgtttccggtccgctcaccatcagtttgaacatgctgcatgtggatgaa
acgggtatctccggcgtgttcgactgccgggcgcctgtctgcgccaccgaagacaatctg
caaaacgtgctggcacgccggttggaagaagccgggtttgcgctggaaccgcacttcagc
cccgcgcaccatgtgccgggggacacgccgttcgtgcgcacgctgctcaaatgctacgag
cagtataccggccgcaaaggggaatgcctgtataccggtggaggcacctatgtgcattct
ttgaaaaacggcgtggcgttcggctgttccctgcccgaaacagacaaccgcatgcacggc
gcggacgaattcgccgtggtggacgagctgcttcttgcggggcagatattcacgcaggcc
atcatcgacctttgcggggcgtga

DBGET integrated database retrieval system