KEGG   Ethanoligenens harbinense: Ethha_1323Help
Entry
Ethha_1323        CDS       T01384                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
eha  Ethanoligenens harbinense
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:eha01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:eha00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1441278..1442081
Genome map
AA seq 267 aa AA seqDB search
MSSETILDTIMANRRQQIAALKEKRPLHALAEQAFSAREKRTAVDFAATLKKPGLSVIAE
VKKASPSKGVIQPDFHPVEIARAYEAAGADAVSVLTEETYFQGGADTLTQVRGAVSLPVL
RKDFIFDEWQIAEACVLGADAILLIASVLDVFALKKLMAVAEMFGLQCLVEVRSESQVRD
ALRAGARVVGVNNRNLATFDVDLSTSARFRHLFPEDVVFVSESGIATAEDMKQAADLGAD
AVLIGETLMRAPDIHAKLKELRSLTHG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgaaacgattttggataccatcatggccaaccgcaggcagcaaatcgccgcg
ctgaaagagaaacggccgctgcatgccctggctgagcaggcgttttccgcgcgtgaaaaa
cgcacggcggtggattttgccgcaacgctgaaaaagcccggcctgtcggtgatcgcggag
gtcaaaaaggcgtcgccgtcgaaaggggtcattcagccggacttccacccggtagaaatt
gcccgtgcatacgaggcggccggagcagatgcggtttccgtgctcaccgaggagacatat
ttccaaggcggcgcggataccttaacacaggtacgcggagccgtttcgctcccggtcctg
cggaaagatttcatttttgacgagtggcaaatcgccgaggcgtgcgtgctgggagcggat
gcgattttgctcattgcctccgtgctggatgtgttcgcactgaaaaaactgatggcggtg
gcggagatgttcgggttgcaatgcctggtggaggtacgcagcgagtcgcaggtgcgcgat
gcattgcgcgcgggcgcgcgcgtggtgggggtaaacaaccgcaacctcgccacgttcgat
gtcgatctgtccacgtccgcgcgcttccggcaccttttcccagaggatgtggttttcgtt
tccgaaagcggcattgccacggcggaagatatgaaacaggccgcagatctgggggcggat
gcggtactcatcggcgaaacgctgatgcgtgcccccgacattcacgcgaaactgaaggaa
ttacggtcattaacgcatggttaa

DBGET integrated database retrieval system