KEGG   Ethanoligenens harbinense: Ethha_1325Help
Entry
Ethha_1325        CDS       T01384                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eha  Ethanoligenens harbinense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ethha_1325
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ethha_1325
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ethha_1325
Enzymes [BR:eha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ethha_1325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1442744..1443931
Genome map
AA seq 395 aa AA seqDB search
MAQKGRYGVHGGQYVPETLMNALEELEQAYARFQNDATFQAELQDLYQNYAGRPSLLYEA
KRMTEDLGGARIFLKREDLNHTGSHKINNVLGQVLMAKKMGKKRVIAETGAGQHGVATAT
VATLMGLECEIFMGREDTDRQALNVFRMEMLGAKVHPVDSGTKTLKDAVNEALRNWTSRV
DDTFYVMGSVMGPHPYPMIVRDFQSIIGKEIKAQCMEQIGRLPDVVMACVGGGSNAMGAF
YDFIGDKTVHLIGVEAAGEGVDTPRTAATIERGTLGVFHGMKSYFLQDEEGQIAPVYSIS
AGLDYPGIGPEHAWLHDNGRAEYVGATDKEAVDAFLYLSKLEGIIPAIESAHAVAYARKL
APTLQKDAVIVINISGRGDKDVAAIARYLGVQLHD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaaaagggcggtatggcgtccatggcgggcagtatgtgcccgaaacattgatg
aacgcgctggaagaactggaacaggcgtatgcccggttccaaaacgacgcgacgttccaa
gcggagttgcaggatttatatcagaactatgcgggccgtccgtctttgttatatgaagca
aagcggatgacggaagacctcggaggcgcgcggatttttctcaagcgcgaagacctcaac
cacaccggctcgcacaagatcaacaacgtgctgggtcaggtgcttatggccaaaaagatg
ggtaaaaagcgtgtgatcgccgagaccggtgcgggccaacacggcgtggctacagcaacg
gtcgccacactgatgggtctggaatgcgagatcttcatggggcgggaggataccgaccgc
caggcgctgaacgtgtttcgcatggaaatgctcggcgcgaaggtgcacccggtagactcc
ggaacgaaaacgcttaaagatgccgtcaacgaggctctgcgcaactggacctcccgcgtg
gacgatacgttctatgtgatgggttcggtaatggggccgcatccctacccaatgatcgtg
cgtgatttccagagcatcatcggcaaagagatcaaagcgcagtgcatggaacagatcggc
cgcctgcccgatgtggtgatggcctgtgtgggcggcggcagcaacgccatgggcgcgttt
tatgatttcatcggggataaaacggtgcatctcatcggcgtggaggctgcgggcgaaggc
gtggacacgccccgcaccgccgccaccatcgagcgcggtacgcttggcgtgttccacggg
atgaaatcgtattttttgcaggacgaagaagggcagattgcgcccgtctactccatttcg
gcaggtttggactatccgggcatcgggccggagcatgcctggctgcatgacaacggccgt
gcggaatatgtcggcgcgaccgacaaggaagccgtggacgcgtttctttatctctccaag
ctggagggtatcatcccggccatcgagagcgcccatgcggtcgcctatgcccgcaagctg
gcgcccacgctgcagaaagacgctgtgatcgttatcaatatttccgggcgcggtgacaag
gacgttgccgccatcgctcgttatctgggggtgcagctccatgactga

DBGET integrated database retrieval system