KEGG   Ethanoligenens harbinense: Ethha_1325Help
Entry
Ethha_1325        CDS       T01384                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eha  Ethanoligenens harbinense
Pathway
eha00260  Glycine, serine and threonine metabolism
eha00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eha01100  Metabolic pathways
eha01110  Biosynthesis of secondary metabolites
eha01130  Biosynthesis of antibiotics
eha01230  Biosynthesis of amino acids
Module
eha_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ethha_1325
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ethha_1325
Enzymes [BR:eha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ethha_1325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADU26865
UniProt: E6U698
Position
1442744..1443931
Genome map
AA seq 395 aa AA seqDB search
MAQKGRYGVHGGQYVPETLMNALEELEQAYARFQNDATFQAELQDLYQNYAGRPSLLYEA
KRMTEDLGGARIFLKREDLNHTGSHKINNVLGQVLMAKKMGKKRVIAETGAGQHGVATAT
VATLMGLECEIFMGREDTDRQALNVFRMEMLGAKVHPVDSGTKTLKDAVNEALRNWTSRV
DDTFYVMGSVMGPHPYPMIVRDFQSIIGKEIKAQCMEQIGRLPDVVMACVGGGSNAMGAF
YDFIGDKTVHLIGVEAAGEGVDTPRTAATIERGTLGVFHGMKSYFLQDEEGQIAPVYSIS
AGLDYPGIGPEHAWLHDNGRAEYVGATDKEAVDAFLYLSKLEGIIPAIESAHAVAYARKL
APTLQKDAVIVINISGRGDKDVAAIARYLGVQLHD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaaaagggcggtatggcgtccatggcgggcagtatgtgcccgaaacattgatg
aacgcgctggaagaactggaacaggcgtatgcccggttccaaaacgacgcgacgttccaa
gcggagttgcaggatttatatcagaactatgcgggccgtccgtctttgttatatgaagca
aagcggatgacggaagacctcggaggcgcgcggatttttctcaagcgcgaagacctcaac
cacaccggctcgcacaagatcaacaacgtgctgggtcaggtgcttatggccaaaaagatg
ggtaaaaagcgtgtgatcgccgagaccggtgcgggccaacacggcgtggctacagcaacg
gtcgccacactgatgggtctggaatgcgagatcttcatggggcgggaggataccgaccgc
caggcgctgaacgtgtttcgcatggaaatgctcggcgcgaaggtgcacccggtagactcc
ggaacgaaaacgcttaaagatgccgtcaacgaggctctgcgcaactggacctcccgcgtg
gacgatacgttctatgtgatgggttcggtaatggggccgcatccctacccaatgatcgtg
cgtgatttccagagcatcatcggcaaagagatcaaagcgcagtgcatggaacagatcggc
cgcctgcccgatgtggtgatggcctgtgtgggcggcggcagcaacgccatgggcgcgttt
tatgatttcatcggggataaaacggtgcatctcatcggcgtggaggctgcgggcgaaggc
gtggacacgccccgcaccgccgccaccatcgagcgcggtacgcttggcgtgttccacggg
atgaaatcgtattttttgcaggacgaagaagggcagattgcgcccgtctactccatttcg
gcaggtttggactatccgggcatcgggccggagcatgcctggctgcatgacaacggccgt
gcggaatatgtcggcgcgaccgacaaggaagccgtggacgcgtttctttatctctccaag
ctggagggtatcatcccggccatcgagagcgcccatgcggtcgcctatgcccgcaagctg
gcgcccacgctgcagaaagacgctgtgatcgttatcaatatttccgggcgcggtgacaag
gacgttgccgccatcgctcgttatctgggggtgcagctccatgactga

DBGET integrated database retrieval system