KEGG   Ethanoligenens harbinense: Ethha_1341Help
Entry
Ethha_1341        CDS       T01384                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
eha  Ethanoligenens harbinense
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:eha01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eha00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eha00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eha00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:eha00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:eha00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1464491..1465456
Genome map
AA seq 321 aa AA seqDB search
MLMYQIGVDLGGTNIAIGLVDDEKKLILKDSVPTALPRSAQAIADDIAALTRSLVERAGL
ALSEARWLGLGTPGTANAETGIIEYANNLGFENVPIRDMLGQALGLPVYIENDANAAAYG
EYVAGAAHGGASAVVITLGTGVGSGVIIDGQIYHGINYAGGEFGHVVIRVDGRPCTCGRH
GCWEAYSSATGLIKSTVEAMEADKSSVMWALVGNDLSKVNGKTAFDGKRAGDDTATRVVD
AYLRDLGQGLVNVINIFQPDVLCIGGGICKEGDGIIKPLEEIIRAERYSKFANKQTALRT
AKLGNDAGIIGAAMIGSLYTE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgtatcagatcggtgtggatcttgggggcaccaacattgcgattggccttgtg
gatgatgagaaaaaactcattttgaaggacagtgtcccgaccgcgttgccgcgctccgcg
caggcgattgcggatgatattgccgccctgacgcgcagcctggtggaacgcgcgggtttg
gcgctttcagaagcacgctggttggggcttggtacacccggcacggccaatgcggagacc
ggcattattgaatatgccaataaccttgggtttgagaatgtgccgatccgcgacatgctc
ggtcaggcgcttggtctgcctgtttacatcgaaaacgacgccaatgccgccgcatacggc
gaatatgtcgcgggcgcggcacacggcggtgcttccgcagtggtcatcacgctcggcacc
ggcgtgggcagcggcgtgatcatagacggacagatttaccacggcatcaactatgcgggc
ggggaattcgggcatgtagtcatccgtgtcgatggcaggccctgcacctgcggcaggcac
ggctgctgggaggcttattcttccgccaccggtctgatcaagagtacggtggaagccatg
gaagcagacaaaagcagcgtgatgtgggcattggtgggaaacgacctctccaaagtgaac
ggcaagactgcatttgacggcaaacgtgcgggagacgacaccgctacccgtgtggtggat
gcctatctgcgggatctcggccagggcctggtcaatgtcatcaacatcttccagccggat
gtgctctgcatcggcggcggcatctgcaaggaaggcgatggcattattaagccgctggag
gagatcatccgcgctgaacggtacagcaagtttgcaaacaagcagacagccctgcgcacg
gctaagctgggcaacgacgcgggcatcattggtgcggcgatgatcggcagcctctacacg
gagtga

DBGET integrated database retrieval system