KEGG   Ethanoligenens harbinense: Ethha_1347Help
Entry
Ethha_1347        CDS       T01384                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eha  Ethanoligenens harbinense
Pathway
eha00010  Glycolysis / Gluconeogenesis
eha00030  Pentose phosphate pathway
eha00051  Fructose and mannose metabolism
eha00052  Galactose metabolism
eha00680  Methane metabolism
eha01100  Metabolic pathways
eha01110  Biosynthesis of secondary metabolites
eha01120  Microbial metabolism in diverse environments
eha01130  Biosynthesis of antibiotics
eha01200  Carbon metabolism
eha01230  Biosynthesis of amino acids
eha03018  RNA degradation
Module
eha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ethha_1347
   00030 Pentose phosphate pathway
    Ethha_1347
   00051 Fructose and mannose metabolism
    Ethha_1347
   00052 Galactose metabolism
    Ethha_1347
  Energy metabolism
   00680 Methane metabolism
    Ethha_1347
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ethha_1347
Enzymes [BR:eha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ethha_1347
Protein phosphatases and associated proteins [BR:eha01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ethha_1347
Messenger RNA biogenesis [BR:eha03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Ethha_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DUF1256 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADU26887
UniProt: E6U6C0
Position
1472271..1473245
Genome map
AA seq 324 aa AA seqDB search
MADLNKTIGVLTSGGDSPGMNAAIRAVVRTGIAKGLHVVGIKRGYNGLITGDLLDMDLRS
VSDIIHRGGTVLYTARSPEFKTEEGMQKAIKVCKEHNIAGIAVIGGDGSFRGASDLSERG
IPCVGIPGTIDNDISSSDYTIGFDTSVNTAMEMVDRLRDTTESHDRCSVVEVMGRRAGWI
ALDTAIAVGATAVLVPEIAYDVEKELVPRIREIQKTGKKHYIIIVAEGVGHTAEIAKLVE
EKTGIETRATVLGHVQRGGSPTVRDRVVASQMGYHAVELLAAGIGNRVVVMKDSKIVDYD
IYEALKMVKPFDKNLYDISNTINI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcagacttgaataagacgattggcgtattgacgagcggcggggattcgcctggcatg
aatgcggccatccgcgccgttgtgcgtacgggcatagcgaaaggcctgcatgtggtcggc
atcaagcgcgggtataacggcctgatcaccggcgacctgctcgatatggatttgcgtagc
gtatccgatatcatccatcgcggcggcacggtattgtataccgcccgcagcccggaattc
aagaccgaagaaggcatgcagaaagccatcaaggtctgcaaagagcacaacatcgccggt
atcgccgtgatcggcggagacggttcgttccgcggcgcgtccgacctttccgaacgcggc
atcccgtgcgttggtatccccggcaccattgataacgacatttcttccagcgattacacc
atcgggttcgatacatccgttaacaccgcaatggaaatggtcgaccgcctgcgtgacacc
accgaatcacacgaccgctgtagtgtggtggaagtgatggggcgtcgggcgggttggatc
gcgctggatacggcaatcgccgtgggtgccaccgccgttctggtaccggagatcgcgtat
gatgtggaaaaagagctggttccccgtatccgtgagattcagaagacgggcaagaagcat
tacataattattgtggccgaaggcgtcggccatacggccgagattgcaaaattggtcgaa
gaaaaaacgggcatcgaaacgcgtgccacggttcttggccatgtgcagcgcggcggttct
ccgacggtgcgtgaccgtgtggtcgcttcacagatgggttatcacgcggtggaactgctt
gcggcgggtatcggcaaccgggtcgttgtcatgaaagacagtaagatcgtggattatgat
atttatgaagccctgaagatggtcaagccgttcgacaagaatctgtatgacatttccaac
accatcaacatctga

DBGET integrated database retrieval system