KEGG   Ethanoligenens harbinense: Ethha_1347Help
Entry
Ethha_1347        CDS       T01384                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eha  Ethanoligenens harbinense
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:eha01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:eha01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eha00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:eha00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:eha00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eha00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:eha00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1472271..1473245
Genome map
AA seq 324 aa AA seqDB search
MADLNKTIGVLTSGGDSPGMNAAIRAVVRTGIAKGLHVVGIKRGYNGLITGDLLDMDLRS
VSDIIHRGGTVLYTARSPEFKTEEGMQKAIKVCKEHNIAGIAVIGGDGSFRGASDLSERG
IPCVGIPGTIDNDISSSDYTIGFDTSVNTAMEMVDRLRDTTESHDRCSVVEVMGRRAGWI
ALDTAIAVGATAVLVPEIAYDVEKELVPRIREIQKTGKKHYIIIVAEGVGHTAEIAKLVE
EKTGIETRATVLGHVQRGGSPTVRDRVVASQMGYHAVELLAAGIGNRVVVMKDSKIVDYD
IYEALKMVKPFDKNLYDISNTINI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcagacttgaataagacgattggcgtattgacgagcggcggggattcgcctggcatg
aatgcggccatccgcgccgttgtgcgtacgggcatagcgaaaggcctgcatgtggtcggc
atcaagcgcgggtataacggcctgatcaccggcgacctgctcgatatggatttgcgtagc
gtatccgatatcatccatcgcggcggcacggtattgtataccgcccgcagcccggaattc
aagaccgaagaaggcatgcagaaagccatcaaggtctgcaaagagcacaacatcgccggt
atcgccgtgatcggcggagacggttcgttccgcggcgcgtccgacctttccgaacgcggc
atcccgtgcgttggtatccccggcaccattgataacgacatttcttccagcgattacacc
atcgggttcgatacatccgttaacaccgcaatggaaatggtcgaccgcctgcgtgacacc
accgaatcacacgaccgctgtagtgtggtggaagtgatggggcgtcgggcgggttggatc
gcgctggatacggcaatcgccgtgggtgccaccgccgttctggtaccggagatcgcgtat
gatgtggaaaaagagctggttccccgtatccgtgagattcagaagacgggcaagaagcat
tacataattattgtggccgaaggcgtcggccatacggccgagattgcaaaattggtcgaa
gaaaaaacgggcatcgaaacgcgtgccacggttcttggccatgtgcagcgcggcggttct
ccgacggtgcgtgaccgtgtggtcgcttcacagatgggttatcacgcggtggaactgctt
gcggcgggtatcggcaaccgggtcgttgtcatgaaagacagtaagatcgtggattatgat
atttatgaagccctgaagatggtcaagccgttcgacaagaatctgtatgacatttccaac
accatcaacatctga

DBGET integrated database retrieval system