KEGG   Ethanoligenens harbinense: Ethha_1347Help
Entry
Ethha_1347        CDS       T01384                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eha  Ethanoligenens harbinense
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ethha_1347
   01230 Biosynthesis of amino acids
    Ethha_1347
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ethha_1347
   00030 Pentose phosphate pathway
    Ethha_1347
   00051 Fructose and mannose metabolism
    Ethha_1347
   00052 Galactose metabolism
    Ethha_1347
  Energy metabolism
   00680 Methane metabolism
    Ethha_1347
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ethha_1347
Enzymes [BR:eha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ethha_1347
Protein phosphatases and associated proteins [BR:eha01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ethha_1347
Messenger RNA biogenesis [BR:eha03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Ethha_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1472271..1473245
Genome map
AA seq 324 aa AA seqDB search
MADLNKTIGVLTSGGDSPGMNAAIRAVVRTGIAKGLHVVGIKRGYNGLITGDLLDMDLRS
VSDIIHRGGTVLYTARSPEFKTEEGMQKAIKVCKEHNIAGIAVIGGDGSFRGASDLSERG
IPCVGIPGTIDNDISSSDYTIGFDTSVNTAMEMVDRLRDTTESHDRCSVVEVMGRRAGWI
ALDTAIAVGATAVLVPEIAYDVEKELVPRIREIQKTGKKHYIIIVAEGVGHTAEIAKLVE
EKTGIETRATVLGHVQRGGSPTVRDRVVASQMGYHAVELLAAGIGNRVVVMKDSKIVDYD
IYEALKMVKPFDKNLYDISNTINI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcagacttgaataagacgattggcgtattgacgagcggcggggattcgcctggcatg
aatgcggccatccgcgccgttgtgcgtacgggcatagcgaaaggcctgcatgtggtcggc
atcaagcgcgggtataacggcctgatcaccggcgacctgctcgatatggatttgcgtagc
gtatccgatatcatccatcgcggcggcacggtattgtataccgcccgcagcccggaattc
aagaccgaagaaggcatgcagaaagccatcaaggtctgcaaagagcacaacatcgccggt
atcgccgtgatcggcggagacggttcgttccgcggcgcgtccgacctttccgaacgcggc
atcccgtgcgttggtatccccggcaccattgataacgacatttcttccagcgattacacc
atcgggttcgatacatccgttaacaccgcaatggaaatggtcgaccgcctgcgtgacacc
accgaatcacacgaccgctgtagtgtggtggaagtgatggggcgtcgggcgggttggatc
gcgctggatacggcaatcgccgtgggtgccaccgccgttctggtaccggagatcgcgtat
gatgtggaaaaagagctggttccccgtatccgtgagattcagaagacgggcaagaagcat
tacataattattgtggccgaaggcgtcggccatacggccgagattgcaaaattggtcgaa
gaaaaaacgggcatcgaaacgcgtgccacggttcttggccatgtgcagcgcggcggttct
ccgacggtgcgtgaccgtgtggtcgcttcacagatgggttatcacgcggtggaactgctt
gcggcgggtatcggcaaccgggtcgttgtcatgaaagacagtaagatcgtggattatgat
atttatgaagccctgaagatggtcaagccgttcgacaagaatctgtatgacatttccaac
accatcaacatctga

DBGET integrated database retrieval system