KEGG   Ethanoligenens harbinense: Ethha_1385Help
Entry
Ethha_1385        CDS       T01384                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
eha  Ethanoligenens harbinense
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Ethha_1385
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ethha_1385
   00620 Pyruvate metabolism
    Ethha_1385
   00650 Butanoate metabolism
    Ethha_1385
  Lipid metabolism
   00071 Fatty acid degradation
    Ethha_1385
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ethha_1385
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ethha_1385
   00626 Naphthalene degradation
    Ethha_1385
Enzymes [BR:eha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ethha_1385
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Ethha_1385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1511848..1514463)
Genome map
AA seq 871 aa AA seqDB search
MATETKEVAQEAQKPDVKQMIDELVAKAQKALDEFSTFNQEQVDKIVHAMALAALDKHMY
LAKLAVEETGRGIYEDKITKNLYASEYIWHDIKYAKTVGVIDENEMEEYVDIAEPVGIIA
GVTPVTNPTSTTIFKSLISVKTRNPIIFGFHPAAQKCCAETARILNEAAVAAGAPENIVQ
FIPHPSIEATNALMNHPGVATILATGGPGMVKAAYSCGKPALGVGPGNVPCYVEKTAKLR
RACHDLILSKTFDNGMICASEQAAIVDKEIAADFEKIMKANGCYFTNPEETVKLGKYVIT
EKMSVNPPVVGQSAVWIAEQAGIKVPADTKVILAKLDKVDFDVPLAHEKLSPVLGYYIAN
STEDAFKAALRMLEIGGLGHSAAIHSTDNDIIMKYGEAMKVGRVLVNSPSSQGGIGDIYN
TNIPSLTLGCGSYGHNSVSQNVSAVNLINKKRIAKRRVNMQWFKVPPKIYFEFDAIQYLE
KMPNISRAFIVTDPVMVKLGNVDKVLYYLRKRKEYCHSEIFSEVEPDPSFETVMRGVEMM
KKFEPDVIIALGGGSSMDAAKGMWLFYEHPDFDFKGAHEKFMDIRKRTYHFPELGQKCQM
VAVPTTSGTGSEVTSFAVITDKVNNFKYPLADYALTPNVAIVDPQFVMTMPKSTTADTGL
DVLTHAIEAYVSVLANDYTDGLALKAIEIVFKYLPRAYADGAKDGEARMKMHNASCIAGM
AFSNAFLGLNHSMAHKLGGEYHIPHGRANAILLPYVVEYNGNPKPTKYAIWPKYETYLAP
QRFQEIARHVGLKASTPEEGVASLVQAIRDLMKTVNEPMSIQATGVPENVFLTNLDSLAD
KAFSDQCTGANPRLPLVSEIAELYKAAYYGK
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaaacaaaagaagtcgcccaggaagcgcagaaacccgacgtcaaacaaatg
attgacgaactggtggcaaaagcgcagaaagctctggacgagttttctaccttcaaccag
gagcaggttgacaaaatcgtccatgccatggcacttgcggcgctggataagcatatgtat
ctggctaaactcgccgtggaagaaaccggacgcggtatttacgaagacaagattaccaaa
aacctgtacgcaagcgaatatatctggcatgacatcaaatatgcaaagaccgtcggcgtc
atcgacgaaaacgagatggaagaatatgtggatatcgccgagcctgtcggtatcatcgcg
ggcgttaccccggtaaccaaccccacctccaccaccatctttaaatccctcatctccgtc
aaaacccgcaaccccatcattttcggtttccatcccgctgcccagaaatgctgcgcggaa
acggcccgcattctgaatgaggcggctgtggctgccggtgcccccgaaaacattgtgcag
ttcatcccccatccttccatcgaagcgaccaatgcgttgatgaatcatcccggtgtcgcc
acgattctggcgaccggcggccccggcatggtcaaggctgcgtattcctgcggcaaaccg
gcgctgggtgtcggccccggcaacgtcccctgctatgtcgaaaaaacagcgaaactccgc
cgtgcctgccatgatctcatcctttccaaaacgttcgacaacggcatgatctgcgcttcc
gaacaggctgcgattgtggataaagaaatcgcggcggattttgaaaagatcatgaaagca
aacggctgctacttcaccaatccggaagaaacggtcaaactcggtaaatatgtgatcacc
gagaaaatgagcgtgaatcccccggtcgtcggccagtccgctgtctggatcgccgagcag
gccggcatcaaagtacctgccgacaccaaggtcattcttgccaaacttgacaaggtcgat
tttgatgtgccgctggctcacgaaaaactttctccggtgcttggttattatatcgccaac
agcacggaggatgctttcaaagctgcgcttcgcatgctggaaatcggcggtctgggtcac
tctgcagccatccactccaccgataacgacatcatcatgaaatacggcgaagccatgaag
gtcggccgtgtgctggtcaacagcccgtcttctcagggcggtatcggcgatatctacaac
accaatattccttcccttacccttggctgcggctcctatggccacaactctgtttcgcag
aacgtcagtgcggtcaacctgatcaacaaaaagcgcattgccaagaggagagtcaacatg
cagtggtttaaagtgccgccgaagatttacttcgagttcgatgcgattcagtacctggag
aaaatgccgaacatctcccgtgcattcatcgtcaccgaccctgtaatggtcaagctcgga
aatgtggataaggttctttattatctccgcaaacgcaaagagtattgccacagtgagatt
ttctccgaagttgagcccgacccgtcttttgaaacggttatgcgcggcgtggaaatgatg
aagaaatttgagccggatgtcatcatcgcactcggcggcggttcttccatggatgccgcg
aagggcatgtggctcttctatgagcatccggactttgatttcaaaggcgcacatgagaaa
ttcatggatatccgcaagcgcacttatcacttccccgaactgggccagaaatgccagatg
gtcgccgtgccgactacttccggcaccggctccgaagtgacgtcttttgcggtcatcacc
gacaaggtcaataacttcaaatatccgctcgccgactatgcgctcactccgaatgtcgct
atcgttgacccgcagtttgttatgaccatgccgaaatccaccacggcggataccggtttg
gacgtgctgacccacgccattgaagcctatgtctccgttttggcaaacgattacactgat
ggtctggccctgaaagcgattgagatcgtcttcaaatatctgccccgtgcctatgcggac
ggtgccaaagacggcgaagcgcgcatgaaaatgcacaacgcttcctgcatcgccggtatg
gcgttcagcaatgcgttccttggcttgaaccactccatggcgcacaaactgggcggcgaa
taccacattccgcacggtcgtgccaacgccattctgcttccctatgtcgttgaatacaac
ggcaatccgaagccgaccaaatatgcgatctggccgaaatacgagacttatcttgccccg
cagcgtttccaagagattgcccgccatgtcggcctgaaggcaagcacaccggaagagggc
gttgcttccctcgtgcaggcgattcgcgatttgatgaagaccgtcaatgagccgatgagc
attcaagccaccggcgtgcccgagaacgtgttcctcaccaatctggattctctggctgat
aaagcgttttccgaccagtgcaccggcgcaaatccgcgtctgccgctcgtcagcgagatc
gccgagctctataaagccgcttattacggcaaataa

DBGET integrated database retrieval system