KEGG   Ethanoligenens harbinense: Ethha_1531Help
Entry
Ethha_1531        CDS       T01384                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
eha  Ethanoligenens harbinense
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:eha00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:eha00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1666374..1667441)
Genome map
AA seq 355 aa AA seqDB search
MPCGDLLDLNDCSVTDWKNLIKLADDIRLNPRDYMHRCEGKVLATLFYEPSTRTQMSFQA
AMLRLGGQIIGFDNPVNSSVSKGETLMDTMRIVSNYADIIVVRHPQEGAARAASLYARCP
VINAGDGGHLHPTQTLTDLVTLSTVKGRLTGLRIGVCGDLKYGRTVHSLLKAMSRFEGNR
FYLISTPELSVPDYCKEILDNAGCPYEEVPALDDCIGELDVLYMTRIQQERFATPEAYEA
QRGVFVLTPEKLQKARADLAILHPLPRVDEIDPAIDEDPRALYFTQARLGMFGRMALMLR
MLEDDITIHSEREHHLHAAVCSNPRCITHTEKYLSRSVCKDENGHDICLYCEEKC
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgccatgcggagatttgctggatctgaacgattgcagcgtgaccgactggaaaaacctc
atcaaactggcggacgacatccgtctgaacccgcgcgactatatgcatcggtgcgaaggc
aaggtgctggccacgctcttctatgagccgagcacccgcacgcagatgtcgttccaggcg
gccatgctgcggcttggcgggcagatcatcgggtttgacaatccggtcaattcgtcggtt
tccaaaggcgaaacgctgatggataccatgcgcatcgtcagcaattacgccgacatcatc
gtggtgcgccacccgcaggagggcgcggcgcgcgccgcgtcgctctatgcgcgctgcccg
gtcatcaacgccggggacggcgggcatttgcaccccacccagacgctcaccgacctggtt
acgctttctaccgtcaaaggcaggctcaccgggctgcgcatcggcgtctgcggcgatctg
aaatacggccgcacggtgcattcgctgctcaaggccatgagccgtttcgagggcaatcgc
ttttacttgatctccacgccggagctttcggtgccggattactgcaaggagatactggat
aacgcgggctgcccatatgaggaagtgcctgcgctggatgactgcatcggcgagcttgat
gtgctgtatatgacgcgcatccagcaggagcgtttcgccacgccggaagcctatgaagcg
cagcgcggcgtgtttgtccttacgcccgaaaaattgcaaaaagcgcgcgcggacctcgcc
atcctgcacccgctgccccgtgtggacgagatcgatcctgccattgacgaggacccacgc
gcgctctattttacgcaggcgcgcctgggcatgttcggccggatggcgctcatgctgcgt
atgctggaggacgatatcaccatccattccgagcgggaacatcacctgcacgcggcggtc
tgttccaatccgcgttgcatcacccacaccgaaaaatacctgtcgcgcagtgtctgcaag
gatgagaacgggcacgacatctgcctgtactgcgaggaaaaatgctga

DBGET integrated database retrieval system