KEGG   Ethanoligenens harbinense: Ethha_1538Help
Entry
Ethha_1538        CDS       T01384                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
eha  Ethanoligenens harbinense
Pathway
eha00521  Streptomycin biosynthesis
eha00523  Polyketide sugar unit biosynthesis
eha01130  Biosynthesis of antibiotics
Module
eha_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Ethha_1538
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ethha_1538
Enzymes [BR:eha01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Ethha_1538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADU27074
UniProt: E6U855
Position
complement(1676475..1677032)
Genome map
AA seq 185 aa AA seqDB search
MNVIKTELDGVLIVEPRVFGDNRGWFMETYSKEKLAPLGVTVDFVQDNQSFSAQKGTLRG
LHFQMHPKAQSKLLRCTHGAILDVAVDIRKGSPNYTKWVAVELSAENKRQLFIPAGFAHG
FVTLTDDVEVQYKVDEYYAPDCDRSIRFDDPAIGVNWGIKAPILSKKDLGAPLLADSDCN
FTYPA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaatcaaaacggagctcgacggcgtgctcatcgtggagccgcgggtgtttggc
gacaaccggggatggttcatggagacctattccaaggaaaagctcgcgccgcttggcgtc
acggtggattttgtgcaggacaaccagtcgttcagcgcccagaagggcacgctgcgcggg
ctgcatttccagatgcaccccaaggcccagtccaagctgctgcgctgcacccacggcgca
attctggatgtggcggtggatatccgcaaaggctcgcccaactacaccaaatgggtggcg
gtggaactgagcgccgaaaacaagcggcagttgttcatcccggcgggcttcgcgcacggg
ttcgtcacgcttaccgacgacgtggaagtgcagtataaggtagatgaatattacgcgccc
gactgcgaccgcagcatccggttcgacgacccggccatcggtgtgaactggggcataaaa
gcccccatcctttccaagaaagacctcggtgcgcccctgcttgcggacagcgactgcaat
ttcacttacccggcgtaa

DBGET integrated database retrieval system