KEGG   Ethanoligenens harbinense: Ethha_1548Help
Entry
Ethha_1548        CDS       T01384                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eha  Ethanoligenens harbinense
Pathway
eha00010  Glycolysis / Gluconeogenesis
eha00051  Fructose and mannose metabolism
eha00562  Inositol phosphate metabolism
eha01100  Metabolic pathways
eha01110  Biosynthesis of secondary metabolites
eha01120  Microbial metabolism in diverse environments
eha01130  Biosynthesis of antibiotics
eha01200  Carbon metabolism
eha01230  Biosynthesis of amino acids
Module
eha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eha_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ethha_1548
   00051 Fructose and mannose metabolism
    Ethha_1548
   00562 Inositol phosphate metabolism
    Ethha_1548
Enzymes [BR:eha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ethha_1548
Exosome [BR:eha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ethha_1548
  Exosomal proteins of bladder cancer cells
   Ethha_1548
  Exosomal proteins of melanoma cells
   Ethha_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU27084
UniProt: E6U865
Position
1685244..1686002
Genome map
AA seq 252 aa AA seqDB search
MSRKTVIAGNWKMNKTPDEAAALINEMKPAADKAACDVVLCVPYVDLPAAVEAAKGSKIS
IGAENVHWEESGAFTGEISAPMLNALGVQYAIVGHSERRQYFGETNETVNKRTAAALAHG
LTVLLCVGETLEEREKGITFDVIAIQLKVALAGISAEAFKNVIIAYEPVWAIGTGKTATA
EQANEVNKFIRDTVAALYGKEAAEETTVQYGGSMNAKNAAELLAKPDVDGGLIGGASLKP
ADFAVILEAASK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtaaaaccgtcatcgccggcaactggaaaatgaacaagaccccggatgaagcc
gccgccctcatcaatgagatgaaacccgccgccgacaaagccgcctgcgacgtggtgctc
tgcgtaccgtatgtggacctgcccgccgccgtggaagccgccaaaggctccaagatcagc
atcggcgccgaaaacgtgcactgggaagaaagcggtgccttcaccggcgagatttccgcg
cccatgctgaacgcactgggcgtgcaatacgccatcgtgggccacagtgaacgccgccag
tatttcggcgaaaccaacgaaaccgttaacaagcgcaccgccgccgccctggcgcacggc
ctgaccgtgctgctgtgcgttggcgaaacgctggaagagcgtgaaaaaggcatcaccttc
gatgtcatcgccatccagctcaaagtggcgctggccggcatttccgccgaagcgttcaaa
aacgtcatcatcgcctatgagccggtctgggccatcggcaccggcaagaccgctacggcg
gagcaggccaacgaggtcaacaagttcatccgcgacaccgtcgccgcgctctatggcaaa
gaagccgccgaggagaccaccgtgcagtacggcggctccatgaacgccaaaaatgccgcg
gagctgctcgccaaacccgacgtagacggcggtctgatcggcggcgcgtcgctgaaaccg
gccgatttcgccgtgatcctggaagcggcttccaaataa

DBGET integrated database retrieval system