KEGG   Ethanoligenens harbinense: Ethha_1548Help
Entry
Ethha_1548        CDS       T01384                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eha  Ethanoligenens harbinense
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ethha_1548
   01230 Biosynthesis of amino acids
    Ethha_1548
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ethha_1548
   00051 Fructose and mannose metabolism
    Ethha_1548
   00562 Inositol phosphate metabolism
    Ethha_1548
Enzymes [BR:eha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ethha_1548
Exosome [BR:eha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ethha_1548
  Exosomal proteins of bladder cancer cells
   Ethha_1548
  Exosomal proteins of melanoma cells
   Ethha_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1685244..1686002
Genome map
AA seq 252 aa AA seqDB search
MSRKTVIAGNWKMNKTPDEAAALINEMKPAADKAACDVVLCVPYVDLPAAVEAAKGSKIS
IGAENVHWEESGAFTGEISAPMLNALGVQYAIVGHSERRQYFGETNETVNKRTAAALAHG
LTVLLCVGETLEEREKGITFDVIAIQLKVALAGISAEAFKNVIIAYEPVWAIGTGKTATA
EQANEVNKFIRDTVAALYGKEAAEETTVQYGGSMNAKNAAELLAKPDVDGGLIGGASLKP
ADFAVILEAASK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtaaaaccgtcatcgccggcaactggaaaatgaacaagaccccggatgaagcc
gccgccctcatcaatgagatgaaacccgccgccgacaaagccgcctgcgacgtggtgctc
tgcgtaccgtatgtggacctgcccgccgccgtggaagccgccaaaggctccaagatcagc
atcggcgccgaaaacgtgcactgggaagaaagcggtgccttcaccggcgagatttccgcg
cccatgctgaacgcactgggcgtgcaatacgccatcgtgggccacagtgaacgccgccag
tatttcggcgaaaccaacgaaaccgttaacaagcgcaccgccgccgccctggcgcacggc
ctgaccgtgctgctgtgcgttggcgaaacgctggaagagcgtgaaaaaggcatcaccttc
gatgtcatcgccatccagctcaaagtggcgctggccggcatttccgccgaagcgttcaaa
aacgtcatcatcgcctatgagccggtctgggccatcggcaccggcaagaccgctacggcg
gagcaggccaacgaggtcaacaagttcatccgcgacaccgtcgccgcgctctatggcaaa
gaagccgccgaggagaccaccgtgcagtacggcggctccatgaacgccaaaaatgccgcg
gagctgctcgccaaacccgacgtagacggcggtctgatcggcggcgcgtcgctgaaaccg
gccgatttcgccgtgatcctggaagcggcttccaaataa

DBGET integrated database retrieval system