KEGG   Ethanoligenens harbinense: Ethha_1611Help
Entry
Ethha_1611        CDS       T01384                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
eha  Ethanoligenens harbinense
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:eha00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1742627..1743526)
Genome map
AA seq 299 aa AA seqDB search
MAHEPNIPLLPTCFIGCETPLAESRIVLFGAPFDGTVTFRPGSRFGPAQMRPDSYGLEAY
SPYQDADLEDAAVHDAGDLDLPFGRVERALAEIGAFSKRVVEAGRQPLMLGGEHLVTLPA
LKAVHAKHPDLCVLHFDAHTDLRADYLGEPLSHATVLRRVWDELGDGRIFQFGIRSGLRE
EFEWAKTHTHLHPFDLDGLDTALDAIGSRPVYVTIDLDVLDPSVFPGTGTPEPGGVTFRE
LLAALCKLRRLRIAGGDVVELAPHYDASGVSTAVACKVVRELAVAMSARESQQEKPGRF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatgaaccgaacataccgctgcttcccacctgcttcatcgggtgcgaaacgccg
cttgcggaaagccggatcgtgctgttcggcgcgccgtttgacggcacggtgacattccgc
cccggctcgcgcttcgggcccgcgcagatgcgccccgattcctacgggctggaagcctac
agcccctatcaggacgccgatctcgaagatgccgccgtgcacgacgcgggcgacctcgac
ctgccgtttggccgggtggagcgcgcgttggcggagatcggcgcgttttcaaagcgggtg
gtggaagcaggcagacagccgctgatgctgggtggcgagcacctggtcacgctgcccgcg
ctcaaggcggtgcatgcgaagcatcccgatctgtgcgtgctgcatttcgacgcgcacacc
gacctgcgcgcggattatctgggtgagccgctttcccatgccacggtgctgcgccgcgtg
tgggacgagctgggcgacgggcgcattttccagttcggcatccgctccggtttgcgcgag
gagttcgagtgggccaaaacgcacacgcaccttcacccgttcgatctggacgggctggac
acggctctggatgccatcggcagtcggccggtgtatgtcaccatcgacctcgatgtgctc
gatccgtcggtcttccccggtaccggtacacccgaacccggcggcgtaacgttcagagaa
ctgctcgccgcgctctgcaaactgcgccgcctgcgcatcgcgggcggggatgtggtggag
cttgccccgcattacgatgcaagcggcgtgtccactgccgtggcctgcaaggtggtgcgg
gaactggccgttgccatgtcggcgcgtgaatctcagcaggaaaagccgggacggttttag

DBGET integrated database retrieval system