KEGG   Ethanoligenens harbinense: Ethha_1788Help
Entry
Ethha_1788        CDS       T01384                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
eha  Ethanoligenens harbinense
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eha00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1925209..1926660
Genome map
AA seq 483 aa AA seqDB search
MPVKNQVMLITYPDSLGRNLKDLRAILKRYFDGVVGGVHILPFFPSSGDRGFSPVTYKKV
SPEFGTFEDIGALAQEYYLMFDYMLNHISAQSAYYQDFLKNKDASLWKDLFIRYKIFWKN
SFPTQEQVDVIYKRKPRAPYVDAHFTDGTEEKVWCTFSEEQIDLNVRSTVTKRFNRNNLE
FLVKQGASIIRLDALAYVTKRPGTSCFFIEPDIWNILNEYSEILKPFHVDILPEIHEHYS
IQLKLAEHGNWVYDFSLPMLVLHALYSGLAERLVHWLEICPRKQFTTLDTHDGIGVVDVK
SLLTDKEIDFTIKALYEHGANIKQKYSSAEYNNLDIYQINCTYYSALGNDDAAYLLARVI
QLFAPGIPQVYYVGMLAGKNDVDLLGRTKEGRNINRHYYTEEEIATETQRPLLKKLFRLM
RFRNSYGAFEGTVSISRQVEPNCFAIHWENSELWTELYVDLAEKKFSVQYFDERRGTDVE
FLV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaaaaaatcaagtcatgctgatcacctatccagatagcttagggcgaaatctc
aaagatctgcgcgctatactcaaacgatatttcgatggcgttgttgggggtgtgcatatt
cttccgtttttcccatccagcggtgatcgtggtttttctcccgtaacatataagaaagtc
tccccagaattcggcacatttgaagacattggcgcgctggcacaggaatattatttgatg
tttgattatatgctcaatcacatttctgcgcaaagcgcctattatcaggattttttaaaa
aacaaggatgcatctctctggaaagatttgtttatccgatataaaattttttggaaaaat
agctttcccacgcaggaacaggtggatgtcatttacaagcgcaaaccccgtgccccatat
gttgatgcacacttcacggatggcaccgaagaaaaagtttggtgtacgttcagcgaggaa
caaattgatttaaatgtgagaagcactgttaccaaacgctttaaccgcaataacctggaa
tttctcgtcaaacagggggcttctatcattcggttggacgcattggcctatgtgactaaa
aggccgggtaccagttgcttttttattgaacccgatatctggaatattctgaatgaatac
agtgaaattctcaagccgtttcatgtagatatcctgcctgaaattcatgagcattacagc
atccagttgaagctggccgagcatggtaactgggtctatgacttttccttgcccatgctt
gtattacacgcattgtattccggcctcgcagaacggttggtacactggcttgaaatatgc
ccccgcaagcagtttacgactttggatacacatgatggcatcggcgtggtggatgtcaaa
agcttgttaaccgataaagaaattgatttcacaatcaaggcgctgtatgaacatggtgcg
aatataaaacaaaaatacagttccgccgaatataacaatctggatatttaccagatcaac
tgcacttattattctgcgctgggaaacgacgacgctgcttacttattggcacgtgttatt
cagttgtttgctccgggtatcccacaggtgtattatgtggggatgctggcgggcaaaaac
gatgttgacttgttagggcgcaccaaagaaggccgtaatatcaatcggcactattataca
gaggaagaaatcgcaactgaaacacagcgcccgctgctaaaaaaactgtttcgtcttatg
cgtttccggaacagttacggtgcgtttgagggaactgtctccatctctcggcaagtagag
ccaaactgttttgcgatccactgggaaaatagcgaactttggaccgaactgtatgttgat
ttggcggaaaaaaagttttccgtgcagtatttcgacgaacggagaggaacagacgtagaa
tttttggtctga

DBGET integrated database retrieval system