KEGG   Ethanoligenens harbinense: Ethha_1922Help
Entry
Ethha_1922        CDS       T01384                                 

Definition
type III site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
eha  Ethanoligenens harbinense
Brite
Enzymes [BR:eha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Ethha_1922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2059061..2062189
Genome map
AA seq 1042 aa AA seqDB search
MKLKFKNQDFQTDAMNAVVDLFTGQEKTRSTFSVVEEKQMSLMNSLGIGNALYIDAQTLS
DNMHTVQKRNNLPMTPNASDMQFCIEMETGTGKTYVYTKTIFELNRKYGFTKFIIVVPSI
AIREGVYKSFEVTKEHFGLQYDNVPCRYFIYNSAKLSDVRQFATSANIEIMIINIDAFKK
SENIINQAQDRLNGETAMRYIQDTHPIVIIDEPQSVDNTPKAKDAIASLNPLCVLRYSAT
HREKINLLYRLTPVDAYLMGLVKQISVSSNQVAGGFNQPYVRLLSVSNDKGFRAKIEIDV
KGKDSIVSRKTLTVKPGDDLFLLSGERDLYEGYSIVGIDCTPGYEHIEFGNTEEVALNKA
IGDVDEGIVKRAQIRRTIEAHLDKELRYTNKGIKVLSLFFIDKVDKYRHEDGTPGIYAKM
FEECYSELIAKPKYAPIRERFTSDVSKVHNGYFSQDKKGRLKDTKGDTQADDDTYNTIMR
DKEWLLSFDCPLRFIFSHSALKEGWDNPNVFQVCTLIDQKSTFTCRQKIGRGMRLCVNQD
GERIEDRNINILHVMATESFAEFADNLQKEIEDDTGMKFGMLQLDLFSGMVYEDKREVEK
AVTSEQAEKVVEALKASGVIAANGKVDTAVKPKEIILPAELSEIKQTVAAVIEHTDTIAP
ETFAGEIYTKTVVEEKQMTYEDAQELMEHFEKKGYITSAGKMKDTMKNALKTGTLDLPKK
YETARNRFETIIANADRKPPVRDASKDVVVHIKKQVMMSPEFLELWNKIKQKTVYRVNID
TNKLIENCIKALQEMPVIPKTRLISQTADIHIEKAGIYHTEREMRTMDIDNSYQTLPDLI
TAISDETLLTPVTVNEILVHSGRCGDFLNNPEAFLEKATEIIRSNRHALAIDGISYVKLD
GKEYYVQEIFDTAELIANLDRNAVKVEHSVYDYIVYDSSTIERPFAVALDNDPDVKMFFK
IPDRFKIETPIGTYNPDWAVYLTKNGEEKLYFILETKGSTNFMDLRTKEQLKIHCGKQHF
KALEDGVELRVATNWNTLKSTL
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaaattcaaaaatcaggattttcaaaccgatgcgatgaacgccgtggttgat
ctgttcaccgggcaggaaaaaacgcgaagtaccttttctgtggtagaagagaaacagatg
tcgctcatgaatagtctcggcataggcaatgctctgtatattgacgcgcaaacgctttct
gacaatatgcacactgttcagaaacgtaataatttacctatgacacccaatgcgtcggat
atgcagttctgtattgagatggagacgggtactggcaagacctatgtttacaccaaaacc
atttttgagctaaatcgtaaatatggtttcaccaagtttatcatagttgtaccttctatc
gccattcgcgaaggggtctataagtcctttgaagtcacgaaagagcacttcggactgcaa
tatgacaatgtgccgtgccggtattttatttacaattccgcaaagctctccgatgtgcgg
cagttcgccacaagcgccaacatcgaaattatgatcataaatattgacgctttcaaaaaa
tccgagaatatcattaatcaggcacaggatagattgaatggtgagaccgctatgcggtac
attcaagatactcaccccattgtcatcattgatgagccgcagagtgtggacaatacacca
aaggcaaaggatgccattgcctccctgaacccactgtgcgtgctacgctattctgccaca
caccgtgagaagattaacttgctttatcgtctgacgccggtggacgcatatctgatggga
ttggttaagcagatttccgtatcatccaatcaggtggctggtggcttcaaccagccgtat
gtccgcctgctttccgtttcaaatgacaagggcttccgcgctaagatagagatcgatgta
aagggtaaagatagcattgtgtctcgcaagacgctaactgtcaaaccaggtgatgatctg
ttcctgctttctggggaacgggatctttacgagggctattccatcgttggaattgattgt
accccaggttatgaacatatcgaatttggcaacaccgaagaagtggcgctgaacaaagcc
atcggtgacgtagatgagggcatcgttaaacgagcgcaaatccgccgcaccatcgaggca
catcttgataaagaattacgttacaccaataagggtattaaggttctttcgctatttttc
attgataaagtggataaatatcgccacgaggacggtactcccggcatttacgctaaaatg
tttgaggaatgttattccgaactgattgcaaaaccaaagtatgctcccatacgggagcga
ttcacttccgatgtctctaaagtacataacggttatttttcacaggataagaagggacgc
ctgaaggacaccaagggtgacacacaggcggacgatgacacctacaacaccattatgcgc
gacaaggaatggttattgtccttcgactgtccgctgcgctttatcttttcccattctgcg
ttgaaagagggttgggacaatccaaatgtgtttcaggtctgcacgctgattgaccaaaaa
tccacttttacctgccgtcagaagatcggacgcggtatgcgcctgtgcgtcaatcaggat
ggtgaacggattgaggataggaatatcaatatccttcatgttatggcaaccgagagtttc
gcggagtttgcggataacctgcaaaaggaaattgaggacgacaccggcatgaagttcggt
atgttacaactcgatttgttctctggtatggtttatgaagacaagcgagaggttgaaaag
gctgtcacgtcggaacaggcggagaaagtcgtagaagctctcaaggctagcggggtcatt
gcggcgaacggcaaagtggatactgctgtaaaaccgaaagaaataatccttccggcagaa
ctctccgagattaaacaaactgtggccgcggtaattgaacatacggataccattgcgccg
gaaacttttgctggtgagatctacacgaaaactgtggtcgaggaaaaacagatgacctat
gaggatgcgcaggaactgatggaacattttgagaaaaaaggctacatcaccagcgctggc
aagatgaaagacactatgaaaaacgccctcaaaaccggaacgcttgatctaccgaaaaag
tacgagactgcgcggaatcgttttgagacaatcattgcgaatgctgaccgcaagcctccg
gtgcgcgacgcttccaaggacgtggtagtgcacatcaaaaagcaagtcatgatgtctccg
gaatttctggagctgtggaacaagatcaaacagaaaacagtctaccgcgttaacattgac
acaaataagctgattgaaaactgcatcaaggcgttgcaggaaatgccagtcattccaaaa
acacggctcatttctcagacagcggatattcatattgaaaaagctggtatatatcacacg
gagcgcgaaatgcgcacaatggatatcgataattcctatcagacactgcctgacctgatt
accgctatcagtgatgagacacttttgacgcctgttacggtcaatgaaattcttgtacat
agcgggcggtgcggcgactttctgaacaatccggaagcctttctggaaaaggctacggag
atcatccgaagcaaccgccatgctctggctatcgacggtattagctatgtaaaactggat
ggtaaggaatactatgtgcaggagatttttgacactgctgaactgattgccaaccttgat
cgcaatgcggtcaaggttgaacatagtgtctacgactatattgtctatgacagtagcact
attgaacgtcccttcgccgtcgcgctggacaatgacccggatgtaaagatgttcttcaaa
atacctgatcgttttaagattgaaacacccattggcacctataatcctgactgggcagtg
tatctgaccaaaaatggcgaagagaaattatactttattttggagacaaagggtagcacc
aactttatggatttgcggacaaaagaacagcttaaaattcactgcggtaaacaacacttc
aaggcgttggaggatggtgtagaattgcgggttgctacgaactggaatacgctaaagtcg
acattgtaa

DBGET integrated database retrieval system