KEGG   Ethanoligenens harbinense: Ethha_1992Help
Entry
Ethha_1992        CDS       T01384                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
eha  Ethanoligenens harbinense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ethha_1992
Enzymes [BR:eha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Ethha_1992
Exosome [BR:eha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ethha_1992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2138058..2139962
Genome map
AA seq 634 aa AA seqDB search
MYTNAPKKTGREQELQCFHESVYPLSFEYFGGHSSHRSKKSGVVFRVWAPKAVSVSIVGD
FNNWDASKNPMISVDDQGVWEGFVPGIKSFDIYKYQIETADGKTLLKSDPYATHMETRPD
TASRYYNLSGYHWKDQEWQKKKEKKSAYDVPMNIYELHAGSWKKYPDGNPFEYRKLAEEL
IPYLQKMGYTHVELMPIMEYPLDNSWGYQVTGYFAPTSRYGSPRDFMAFVDYCHQADIGV
IMDWVPAHFPKDAHGLYRFDGDCCYEYTDPLKQEHKSWGTCVFDYSKSEVRSFLVSNAIF
WLQKYHIDGLRVDAVASMLYLDYDRKNGEWRPNQYGGHENLEAVSFLQELNREVFSRFPN
ALMIAEESTAWPLVTKPVDVGGLGFNFKWNMGWMNDMLDYVSTDPYFRKDHHKDITFSFH
YAFSENYILPISHDEVVHGKRSLLEKMPGDKAEQFAGVRVFLAYMIAHPGKKLLFMGSEF
GQVHEWDCHDALQWQLLGEKGHQNLQDFTAALNHFYLDQSPLWQNDFSWEGFQWISYDDN
LQNIIAFRRIDRKGEELVCLFNFAPVKRDDYRIGIPAAGYYQEAFNTDAEQFGGTGESNK
EPVPTEKIPLHGYQQSIALTVPPMAALFLKHQPK
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtacacaaatgcaccaaaaaaaacaggacgtgaacaagaattacagtgtttccacgag
agcgtatacccgctgtcctttgaatatttcggcgggcactcctctcatcgcagcaaaaaa
tccggcgttgtgttccgtgtgtgggcacccaaagcagtttccgtttccattgtgggagat
ttcaacaactgggacgcatccaaaaacccgatgatctccgtggacgaccagggggtatgg
gaaggatttgtgcccggcatcaaaagcttcgacatctacaaatatcagattgaaacagcg
gatgggaaaactcttctcaaaagcgacccttatgccacgcacatggaaacccggccggac
accgcttcgcgttactacaatctttcgggatatcactggaaagatcaggagtggcagaaa
aagaaagaaaagaaatccgcttacgatgttcccatgaacatttatgagctgcatgccgga
tcctggaaaaaatatcctgacggcaatccgtttgaataccgcaagctggccgaagagctc
attccctacctccagaaaatggggtatacccatgtggaactgatgcccatcatggagtat
ccgctggacaattcctggggctaccaggtcaccggctatttcgcccccacctcccgttat
ggctcgcccagggacttcatggctttcgtggattactgccaccaggccgacatcggcgtc
atcatggactgggtgcccgcgcattttcccaaagacgcgcacgggctgtaccgcttcgac
ggggactgctgctatgagtatacggacccgctcaagcaggaacacaaatcctggggcacc
tgcgtgtttgattacagcaaaagcgaagtgcgcagcttcctcgtctcgaacgccatcttc
tggctccaaaaatatcacatcgacggcctgcgcgtggacgcggtcgcttccatgctctat
ctggactatgaccgaaaaaacggcgagtggcggcccaaccagtacggcgggcacgaaaac
cttgaagcggtttcgttcctgcaggaactgaacagggaagtattttcccgcttccccaac
gcgctgatgatcgcggaggagtccaccgcgtggccgctggtgaccaaaccggtggacgtc
ggcgggctgggcttcaatttcaagtggaatatgggctggatgaacgacatgctcgattat
gtctccaccgacccctatttccgtaaagaccaccacaaagacatcacgttctcgttccac
tatgccttttccgaaaactacatcctccccatctctcacgacgaagtggtgcatggcaag
cgctcgctgcttgagaaaatgccgggcgataaggcggagcaattcgccggcgtgcgcgtc
ttcctggcctacatgatcgcccaccccggcaaaaagctgctgttcatgggcagcgagttt
ggccaggtgcacgaatgggactgccatgacgcgctgcagtggcagctgctcggtgaaaaa
ggccatcagaacctgcaggatttcaccgcggccctcaaccacttctatctcgaccagtcg
cctttgtggcagaatgatttctcatgggagggattccaatggatatcttacgacgacaac
ctgcaaaacatcatcgcgttccggcgtattgaccggaaaggtgaagagctcgtctgcctg
ttcaatttcgccccggtaaaacgtgacgattaccggatcggcattcctgccgccggctat
tatcaggaagcgttcaacacggatgcggaacagtttggaggaacgggggaaagcaataag
gagccggtgccaaccgaaaagattcctctccacgggtaccagcaatccattgcgctcacc
gttccgccgatggcggcactcttcttgaagcatcaaccaaaatga

DBGET integrated database retrieval system