KEGG   Ethanoligenens harbinense: Ethha_2102Help
Entry
Ethha_2102        CDS       T01384                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
eha  Ethanoligenens harbinense
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ethha_2102
Enzymes [BR:eha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Ethha_2102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2250969..2251538
Genome map
AA seq 189 aa AA seqDB search
MVDKERAARAIRELLAAVGENPDRPGLQETPERVARMYEELFAGLERDPLEDVKLFGEGL
PDELVVVRDIPFYSMCEHHLLPFYGQAHIAYLPRDGRILGLSKLARIVDTLARKPQLQER
LTTEIADAVERAATTRGVAVVVVAEHLCMTMRGIKKPGAKTVTSRSIGELKTDAALRAEA
AALLKPYTR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaagaaagagccgcgcgagccattcgggagctgctggcggcggtgggcgaa
aaccccgaccgtcccggcctgcaagagacccccgaacgggtcgcgcggatgtatgaggaa
ctgttcgcgggtttggaacgcgacccgcttgaggatgtcaaactgttcggggagggactg
cccgacgagctggtcgtggtgcgggacatccccttttattcgatgtgcgagcatcatctg
ctcccgttctacggccaggcacacatcgcctatctgccgcgggacgggcgcatcctcggc
ctaagcaagctggcgcgcatcgtggacacgctggcgcgcaaaccccagttgcaggagcgg
ctgaccaccgagatcgccgacgccgtggaacgcgccgccacgacgcgcggcgtggcggtg
gtggtggtagcggaacacctgtgcatgaccatgcgcggcatcaaaaagccgggtgccaaa
accgtcacctcccggtccatcggcgagctgaaaacggacgctgccctgcgcgctgaagcc
gccgcattgctcaagccatacaccagataa

DBGET integrated database retrieval system