KEGG   Ethanoligenens harbinense: Ethha_2105Help
Entry
Ethha_2105        CDS       T01384                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
eha  Ethanoligenens harbinense
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eha00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2253091..2253597
Genome map
AA seq 168 aa AA seqDB search
MNVPVAHDVYIALGSNMGDRAGYLEAARKKIAESGIRLTAVSGIYETAPVGYTEQPAFLN
QVCRACTALEPQSLLETLQRIETALARRRIVHWGPRTIDLDLLLYDDLHMQTETLTLPHP
RMFERAFVLVPLRDVWPAAEIAGKPPAEWIASCADKNGVRPYAPPSKK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgttcccgtcgcgcatgacgtatacatcgcgctcggctccaacatgggtgaccgc
gccgggtatctggaagccgccaggaaaaaaatagcagaatccggtatccggctgactgcg
gtgtccggcatctacgagaccgcccccgtgggctacaccgagcagccggcgtttctcaac
caggtctgccgggcatgcaccgcgctggaaccgcagtccttgctcgaaaccttgcagcgg
atcgaaaccgcgctggcaagacggcgcatcgtccactgggggccgcgcaccatcgacctt
gacctgctgctgtatgacgatttgcacatgcaaaccgaaacgctgaccctcccgcacccg
cgcatgtttgagcgggcgttcgtgcttgtgccgctgcgggacgtctggcccgcggcagaa
atcgcgggcaaaccgccggcggaatggatcgcgtcctgcgcggacaaaaacggcgtgcgg
ccttacgcgccgccgtccaaaaagtga

DBGET integrated database retrieval system