KEGG   Ethanoligenens harbinense: Ethha_2193Help
Entry
Ethha_2193        CDS       T01384                                 

Definition
nucleotidyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eha  Ethanoligenens harbinense
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ethha_2193
   00052 Galactose metabolism
    Ethha_2193
   00500 Starch and sucrose metabolism
    Ethha_2193
   00520 Amino sugar and nucleotide sugar metabolism
    Ethha_2193
Enzymes [BR:eha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ethha_2193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2343962..2344834)
Genome map
AA seq 290 aa AA seqDB search
MKIKKAIIPAAGLGTRVLPASKAIPKEMLPLVDKPAIQYIVEEAVNAGIEEILIITNRNK
TVMEDHFDRSPELEQKLAEAGKLDKLQIVLDVANLAEITYMRQKETRGLGHAVLIARPFV
GNEPFAVLYGDDVIVGKKPAIGQLAAAYEQYGLGVAGIKQVPESDIHKYSSLAVEPLHDS
VFKVTDMVEKPQTPDEVLSLYSILGRCVLPPEIFDILEETPVGAGGELQLTDAMRTLART
KGMVGVDYEGVRYDMGSKLGIMKASVEAALIHDEIKDDFRAYIKQLAQTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaaaaggcgatcattccggcggcgggcctgggaacgcgcgtgcttcccgca
tccaaggccatccccaaagaaatgcttccgctggtagacaagccggctatccagtatatt
gtagaagaggcggtcaacgccggcatcgaggaaatcctcatcatcaccaaccgcaacaaa
acggtgatggaagaccatttcgaccgcagccccgagctggaacagaaactggccgaggcc
ggcaagctggacaaactccagatcgtgctggatgtggccaacctggctgagatcacctat
atgcgtcagaaagagacacgcggcctggggcacgcggtgctgatcgcccgcccgtttgta
ggcaacgaaccgtttgccgtcctgtatggcgacgatgtgatcgtcgggaaaaaaccggcc
atcggccagcttgccgctgcgtatgaacaatacggcctgggcgtggcgggcatcaagcag
gtgccggagagcgacatccataagtattcctcgctggcggtggagccgctgcacgacagt
gtgttcaaagtgaccgacatggtcgaaaaaccgcagacccccgacgaggtgctgtccctc
tattccattttggggcggtgcgtgctgccgccggagatattcgatatcttggaagaaacg
ccggtgggtgcgggcggcgaactgcagctgaccgacgccatgcgtaccctcgcgcgcacc
aaaggcatggtgggcgttgattacgaaggcgtgcggtacgacatgggcagcaagctcggt
atcatgaaggcttcggtggaagcggcgctcatccacgacgagatcaaggacgatttccgc
gcctacattaagcagctggcccagacgatttga

DBGET integrated database retrieval system