KEGG   Ethanoligenens harbinense: Ethha_2206Help
Entry
Ethha_2206        CDS       T01384                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
eha  Ethanoligenens harbinense
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:eha00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2356965..2357840
Genome map
AA seq 291 aa AA seqDB search
MKQIVLQASAKINLSLDITGRRADGYHELDTVMQSVSLADTVELSKTADGTISVRCDDTS
IPQGGDNIAHRAALAYFDAAGLPAQSVSVFIRKRIPSQAGLGGGSADAAAVLHGLCALFS
PLPEDALLRAGASAGADVPFCLTGGTLRARGIGELLSPVPVLPACSMLIVKPPIGMSTAA
AYAAYDHLPTGCPPRTGALLTALEDGSLDAIGAALDNAFANASPLPAVESIRRTLRAAGA
VGACMSGSGTAVFGLFADEHTARHCAGTFDGTGVACFLCHPVSTGCIPVSA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaatcgtcttacaggccagcgccaaaatcaacctgtcgctggatatcaccggg
cggcgtgcggacggctaccatgagctggacaccgtaatgcagtccgtttcgctggcggat
acggtggaactgtccaaaacggccgacgggaccatatccgtgcgctgcgacgacacatcc
atcccgcagggcggggacaacatcgcccaccgcgccgcgctggcttattttgacgcggcg
ggcctgccggcgcagagcgtgtcggtcttcatccgcaagcgcattccctcgcaggcggga
ctgggaggcggcagcgcggacgcggccgccgtgctgcacggcttgtgcgcgctcttttcc
cccctgcccgaagacgcgctgctgcgggcaggcgcatcggcaggggcggacgtaccgttt
tgcctgacgggcggcaccctgcgcgcgcggggtatcggcgaacttctgtcccccgtaccc
gtgctgccggcctgctccatgctgatcgtcaaaccgcccatcggcatgtccaccgccgcc
gcctacgccgcctatgaccacctgcccacaggatgcccgccgcgcaccggcgcgctcctt
accgcactggaagacggcagtctggatgctatcggcgcggcgctggacaatgcgtttgcc
aatgccagcccgctgcccgccgtggaatccatccgccgcaccctgcgcgccgccggggcc
gtcggtgcctgcatgagcggaagcggcacggccgtgttcgggctgttcgccgatgagcac
accgcacgccactgtgccggaacgtttgacggcaccggggtcgcctgtttcctctgccac
cctgtctccacggggtgtatacccgtatctgcttaa

DBGET integrated database retrieval system