KEGG   Ethanoligenens harbinense: Ethha_2314Help
Entry
Ethha_2314        CDS       T01384                                 

Definition
oxidoreductase/nitrogenase component 1
Orthology
K02591  
nitrogenase molybdenum-iron protein beta chain [EC:1.18.6.1]
Organism
eha  Ethanoligenens harbinense
Pathway
Chloroalkane and chloroalkene degradation
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Nitrogen fixation, nitrogen => ammonia
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:eha00910]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:eha00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2485336..2486721
Genome map
AA seq 461 aa AA seqDB search
MSLTIKDKERAGVINPMYNCQPCGAQFAGIGIRDCIPLVHGGQGCCTFVRLLFAQHFKEN
FDIASSSLHESAAVLGGMKNVEVGIDTLVQRYPDLRIVPIITTCSTETIGDDVDGVARKA
RRMLKEQFPNRSVKLVPVHTPSYSGSHVKGYDTALLALTKELAKKTESNGKLNIITGWLN
PGDVTEIKYILNEMGVEGNILIDTETFDAPTMPDKDAFAYGNTTIEDFVETPNAVGTIAL
CPFEGGSTAQFLQDEFDVPAVIGPTPIGIENTDKLIQNISKLTGKEIPESLVVERGKALD
AIADLVHMFFADKKVAIYGDPDLVIGLAQFCLEVELQPVLLLLGDDNKTYSKDPRFKELE
EKANCDIEVVCNADMFELEDRIKNKGADIDLILGHSKGRYIAIDNNIPMVRVGFPTFDRA
GLWKYPIIGYKGASMLAESIANAMFTDMEYKHKDEYLLNVW
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaaccataaaggataaagagcgcgccggcgttatcaatcccatgtataactgc
cagccttgcggcgcgcagtttgccgggatcggtatcagggactgcattccgctggttcat
ggcggccagggatgctgcacgtttgtccggcttctgtttgcgcagcatttcaaagaaaac
ttcgacattgcttcctcctcgctgcacgaaagcgccgcggtgcttggcggcatgaagaat
gttgaggtgggcatcgacacattggtccagcgctaccccgatctgcgcatcgtccccatc
atcacgacctgctcgaccgaaaccatcggcgatgacgtggacggtgttgcgcgtaaggcc
agacgcatgctcaaagagcagtttccgaaccgttcggtcaagctggttccggtgcatacc
cccagctacagcggcagccacgtcaaaggctacgacacagcgcttctcgcactgacgaag
gagcttgcaaaaaagacagaatcaaacggaaagctcaacatcattaccggctggctgaac
cccggcgatgtgacggaaatcaaatacatcctcaacgagatgggggtcgaaggcaacatc
ctgatcgacaccgaaaccttcgatgcgccgaccatgcccgacaaagacgcgtttgcctat
gggaacacaaccatcgaagattttgtcgaaacgccgaacgccgtcggcaccattgccctc
tgcccgtttgaagggggcagcaccgcgcagttccttcaggatgagttcgacgtaccggct
gtcattgggcccacgcccattggcattgaaaacaccgataaactgattcagaacatcagc
aagctgaccggaaaggaaattccggaatcactggttgtggaacgcggcaaggcgctggac
gcgatcgccgatctggtgcacatgttctttgcagacaaaaaggttgccatctacggcgac
ccagaccttgtgatcggcttggcgcagttctgtctggaggttgagctgcagccggtgctt
ctcctgctcggcgacgacaacaagacctactcgaaagacccccgtttcaaagagttggaa
gagaaggccaactgcgatatcgaggttgtctgcaacgccgatatgtttgagcttgaggac
cgcattaagaataagggagcggatatcgacctcattctgggccactcgaagggccggtat
atcgccattgacaacaacattccgatggttcgggtcggcttcccgaccttcgaccgcgcg
ggcctttggaaatatccgatcattggctacaagggtgcttccatgctcgcagaaagcatt
gcaaacgccatgttcaccgacatggaatataagcacaaggacgagtacctgctcaacgtc
tggtaa

DBGET integrated database retrieval system