KEGG   Ethanoligenens harbinense: Ethha_2475Help
Entry
Ethha_2475        CDS       T01384                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eha  Ethanoligenens harbinense
Brite
Enzymes [BR:eha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Ethha_2475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2655232..2655900
Genome map
AA seq 222 aa AA seqDB search
MGSVLHGIASKLKWKLLIAAAPVLLISALGVLVVLVAAVSIQHASSSESTASTTSSAAYI
PGQVTNLPISKMGLVFIEQWEGAYSNWYDDGYGNMTIGYGHTGPLPTGFTSPLTTGPGGT
AEQLLIQDLSSGGYCSSVQKEFQGVALNQNQMDALISLAYNIGGNAWNSLSLTQAVKTGA
PPDIITADFEKICYAGTTYSPGLYRRRVAEALLYTQGTYTYP
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgggttccgttctccatgggattgcctcaaaactcaaatggaagctgctcattgccgcc
gcacctgtcctcttaatttcggccctcggcgtgctggttgtattggtcgcggcggtatca
atccagcatgcgtcctcatcggaatcaaccgcgtctaccaccagcagcgcggcgtacatt
cccggtcaggtgacaaacctgccaatcagtaaaatgggacttgtatttattgaacaatgg
gaaggggcctattccaactggtacgatgacggttatgggaacatgaccatcggatatggc
cacacggggccgcttcctactggctttacgtccccgctcaccacaggccccggcggtacg
gcagagcaacttctcatacaggatttaagcagcggtggatactgctcctccgttcaaaaa
gagttccagggcgtcgccttaaaccagaaccaaatggatgcattgatcagtcttgcttac
aacatcggaggaaacgcatggaatagcctgagccttacgcaagcggtcaaaacgggtgcg
cctcctgacattatcacagcggattttgaaaaaatatgctacgcaggaaccacatattca
cccggtctgtaccggcgtcgtgtggcggaggcgctgctgtacacacaggggacttataca
tatccgtaa

DBGET integrated database retrieval system